[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69180.1
DDBJ      :             putative hydrogenase
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  141/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:401 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   160->306 3cgvA PDBj 1e-07 34.8 %
:RPS:PDB   39->382 3cgvA PDBj 1e-15 17.3 %
:RPS:SCOP  124->304 3c96A1  c.3.1.2 * 5e-12 15.2 %
:HMM:SCOP  13->388 1k0iA1 c.3.1.2 * 5e-37 28.8 %
:RPS:PFM   80->355 PF05834 * Lycopene_cycl 2e-05 28.7 %
:HMM:PFM   94->296 PF01494 * FAD_binding_3 1.9e-09 23.7 194/356  
:HMM:PFM   16->81 PF00890 * FAD_binding_2 5.7e-11 34.8 66/421  
:BLT:SWISS 39->345 Y1602_METBF 2e-23 26.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69180.1 GT:GENE BAC69180.1 GT:PRODUCT putative hydrogenase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1812317..1813522) GB:FROM 1812317 GB:TO 1813522 GB:DIRECTION - GB:PRODUCT putative hydrogenase GB:NOTE PF01266: FAD dependent oxidoreductase GB:PROTEIN_ID BAC69180.1 LENGTH 401 SQ:AASEQ MSSENSSTDDAQQVWDVVVVGAGPAGASAAYAAAVAGRSVLLLEKAELPRYKTCGGGIIGPSRDALPPGFELPFQDRVHAVTFSNNGRFTRTRRSKQMLFGLINRPEFDQQLVEHAQKAGAELRTGVTVSRVEQHGSAVPDRRTVAVVLQGGDSLLARAVVGADGSASRIGAHVGVKLDQVDLGLEVEIPVPETVAEDWQGRVLIDWGPMPGSYGWVFPKGDTLTVGVISARGEGAATKRYLEDFIARLGLAGFEPSISSGHLTRCRADDSPLSRGRVLVCGDAAGLLEPWTREGISFALRSGRLAGEWAVRIAEAHDAVDTRRQALNYAFAIKAGLGVEMSVGKRMLTAFERRPGMFHAALTGFRPAWKAFAQITRGATSLGELVRSHPMAGRVLTSLDR GT:EXON 1|1-401:0| BL:SWS:NREP 1 BL:SWS:REP 39->345|Y1602_METBF|2e-23|26.6|293/387| SEG 17->37|vvvvgagpagasaayaaavag| BL:PDB:NREP 1 BL:PDB:REP 160->306|3cgvA|1e-07|34.8|141/370| RP:PDB:NREP 1 RP:PDB:REP 39->382|3cgvA|1e-15|17.3|336/370| RP:PFM:NREP 1 RP:PFM:REP 80->355|PF05834|2e-05|28.7|254/368|Lycopene_cycl| HM:PFM:NREP 2 HM:PFM:REP 94->296|PF01494|1.9e-09|23.7|194/356|FAD_binding_3| HM:PFM:REP 16->81|PF00890|5.7e-11|34.8|66/421|FAD_binding_2| GO:PFM:NREP 2 GO:PFM GO:0016117|"GO:carotenoid biosynthetic process"|PF05834|IPR008671| GO:PFM GO:0016705|"GO:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen"|PF05834|IPR008671| RP:SCP:NREP 1 RP:SCP:REP 124->304|3c96A1|5e-12|15.2|178/269|c.3.1.2| HM:SCP:REP 13->388|1k0iA1|5e-37|28.8|271/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 239 OP:NHOMOORG 175 OP:PATTERN ----------------11-----1-------112-11-----1-212112332-----------2--- -1-1-----------------1---2------1111-----122-1---------1----22----11111---------1--11----------------------------------------1212311111211111-----2122112112221221-11212213112-22211111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----2-----------------------------111--------------1--------------------------1------1-----------------------------------------------------------------------------------------------------------------------------1--11-1--1-----------1---------------------------------------------------------------------1-11-------------1111111111-1111-11111111111111-------11111111111111111----1111----------------------------1------------------------------------------------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111I---113134-1111----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 363 STR:RPRED 90.5 SQ:SECSTR ######################################cEEEcccccTTcccccccEEETHHHHHTTccccTTTEEEEEcEEEEEcTTccccEEEccccEEEEcHHHHHHHHHHHHHHHTcEEEccccEEEEEEETTEEEEEEEEEEEETTEEEEEEEEEEEcccTTcHHHHHHTccTTcccGGGEEEEEEEEEcccccTTEEEEEccTcTTEEEEEEEEETTEEEEEEEETTTcccHHHHHHHHHHHHHcHHHHTcEEEEEEEEEEEcccccccETTEEcGGGGTcccTTTcccHHHHHHHHHHHHHHHHHHHHTcccHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHTTcccccccHHHHHHHHcccccccccHHHHHHHTTc DISOP:02AL 1-15| PSIPRED ccccccccccccccEEEEEEcccHHHHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHHHHHHHccccccccEEEEEcccEEEEcccccccEEEEEEHHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEEcccccHHHHHHHccccccccEEEEEEEEEccccccccccEEEEccccccccEEEEEEccccEEEEEEEEccccccHHHHHHHHHHHHccccccHHccccEEEEccccccEEEcccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHHHccccccHHHHccccccHHHHHHccc //