[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69184.1
DDBJ      :             putative secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->45 PF03880 * DbpA 0.0005 27.6 29/74  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69184.1 GT:GENE BAC69184.1 GT:PRODUCT putative secreted protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1817167..1817361) GB:FROM 1817167 GB:TO 1817361 GB:DIRECTION - GB:PRODUCT putative secreted protein GB:PROTEIN_ID BAC69184.1 LENGTH 64 SQ:AASEQ MKKRSMLAIASLAAGFVVAAVTPSHAVDGDVIGDLNVNDTISTVDHTINSDSLAVDDNALGRKG GT:EXON 1|1-64:0| HM:PFM:NREP 1 HM:PFM:REP 17->45|PF03880|0.0005|27.6|29/74|DbpA| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 63-64| PSIPRED ccccHHHHHHHHHccEEEEEccccccccccEEEEcccccHHHHHHHHcccccEEEccccccccc //