[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69188.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.12
:439 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   160->352 3cv2A PDBj 2e-06 17.6 %
:RPS:SCOP  168->360 1sgjA  c.1.12.5 * 7e-07 17.9 %
:HMM:SCOP  87->363 1sgjA_ c.1.12.5 * 9.3e-12 25.5 %
:RPS:PFM   159->308 PF03328 * HpcH_HpaI 3e-04 34.4 %
:HMM:PFM   194->308 PF03328 * HpcH_HpaI 1.4e-09 26.9 104/221  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69188.1 GT:GENE BAC69188.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1822322..1823641) GB:FROM 1822322 GB:TO 1823641 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF03328: HpcH/HpaI aldolase/citrate lyase family GB:PROTEIN_ID BAC69188.1 LENGTH 439 SQ:AASEQ MGGCGMGQGQQEKVATSLAGAVSEGISATLAPVDAELERRYPGDPGTRQPVHTVYVPGDVFAADTIRSWGDRALAALDEHAPDAASFATALGLAEELAAPVYDRVRAKLEREPIEDLRVDFEDGYGPRPDAEEDEAAARAARLIAEAYRNGTAAPYMGIRMKCMEAPVRDRGIRTLDVFLTGLMEAGGLPDGLVLTLPKVTYAEQVTAMVRLLEAFEKARGLEPGRLGFEIQIETSQSILATDGTATVARMIQAAEGRATGLHYGTFDYSACLGVSAAYQASDHPAADHAKAIMQVAAAGTGVRVCDGSTNVLPVGPTEQVHDAWRLHYGLTRRALARAYYQGWDMHPGHIPTRYAAVFAFYREGFEQAAARLSRYADRAGGDVMDEPATAKALSGYLLRGLDCGALDVAEVAEATGLTRTDLEGFAGPRRGDLTASAK GT:EXON 1|1-439:0| SEG 1->11|mggcgmgqgqq| SEG 88->99|atalglaeelaa| SEG 130->147|daeedeaaaraarliaea| RP:PDB:NREP 1 RP:PDB:REP 160->352|3cv2A|2e-06|17.6|187/523| RP:PFM:NREP 1 RP:PFM:REP 159->308|PF03328|3e-04|34.4|128/219|HpcH_HpaI| HM:PFM:NREP 1 HM:PFM:REP 194->308|PF03328|1.4e-09|26.9|104/221|HpcH_HpaI| GO:PFM:NREP 2 GO:PFM GO:0006725|"GO:cellular aromatic compound metabolic process"|PF03328|IPR005000| GO:PFM GO:0016830|"GO:carbon-carbon lyase activity"|PF03328|IPR005000| RP:SCP:NREP 1 RP:SCP:REP 168->360|1sgjA|7e-07|17.9|162/231|c.1.12.5| HM:SCP:REP 87->363|1sgjA_|9.3e-12|25.5|231/0|c.1.12.5|1/1|Phosphoenolpyruvate/pyruvate domain| OP:NHOMO 33 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ---1----------1------1--11-----1----1211-111--1-----1111--------2-2222-----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 55.8 SQ:SECSTR ###############################################################################################################################################################cTTcEEEEEEETTEEEEHHHHHHHHHHHHTTcccEEEEcccccHHHHHHHHHHHHHHHHHTTccTTccEEEEEEccHHHHTcHHHHHHHTHHHHHTTTTEEEEEEcHHHHHHHHHccccGGGcccHHHHHHHHHHHHHHHHTTcEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHTcccEEEccGGGHHHHTTccccTTcccTTcccccHHHHHccccccccHHHHHHHHHHHHHHHHHTT################################### DISOP:02AL 1-13, 434-439| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHcHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccHHHHHHHHHHccccccccccccEEEEccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccHHHHHcccccccccccccccccccEEEcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEEcccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHcccccccccccccc //