[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69189.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  58/915 : Eukaryota  54/199 : Viruses  0/175   --->[See Alignment]
d.151.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->302 3g6sA PDBj 4e-24 32.0 %
:RPS:PDB   49->302 2ddrB PDBj 4e-16 16.3 %
:RPS:SCOP  49->300 1zwxA1  d.151.1.3 * 2e-13 10.8 %
:HMM:SCOP  44->301 2f1nA1 d.151.1.1 * 9.6e-38 28.3 %
:HMM:PFM   48->300 PF03372 * Exo_endo_phos 5.9e-21 25.0 228/276  
:HMM:PFM   12->29 PF10518 * TAT_signal 0.00011 50.0 18/26  
:BLT:SWISS 52->296 YL388_MIMIV 2e-06 27.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69189.1 GT:GENE BAC69189.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1823751..1824662 GB:FROM 1823751 GB:TO 1824662 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF03372: Endonuclease/Exonuclease/phosphatase family GB:PROTEIN_ID BAC69189.1 LENGTH 303 SQ:AASEQ MTEGGRVSNTSRVTRRTGLRTAAAVAAALPLLSASPASASRNRGRRLDVMTFNLRFASASEPHSWAVRRPVMRELLRRERPHVIGTQEGLYQQVRDIEADLGPHYDWIGTGRAGGSRDEFMAVFYDTRRLAPLEYDHFWLSDTPDVIGSNTWGGGSIRMVTRVRFRDLADGDRPFHFLNTHLDNASQYARARAAALIADRIAGLDRSQPLVVTGDFNAAAHKNAVYETMLGAGLVDTWDTAAERGKLYGTFHGYKPLVPDGDRIDWILASPGVAAHCASINAFSSNGQFPSDHLPVQASLRLA GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 52->296|YL388_MIMIV|2e-06|27.1|236/100| SEG 6->46|rvsntsrvtrrtglrtaaavaaalpllsaspasasrnrgrr| SEG 189->205|araraaaliadriagld| BL:PDB:NREP 1 BL:PDB:REP 51->302|3g6sA|4e-24|32.0|244/256| RP:PDB:NREP 1 RP:PDB:REP 49->302|2ddrB|4e-16|16.3|251/289| HM:PFM:NREP 2 HM:PFM:REP 48->300|PF03372|5.9e-21|25.0|228/276|Exo_endo_phos| HM:PFM:REP 12->29|PF10518|0.00011|50.0|18/26|TAT_signal| RP:SCP:NREP 1 RP:SCP:REP 49->300|1zwxA1|2e-13|10.8|251/288|d.151.1.3| HM:SCP:REP 44->301|2f1nA1|9.6e-38|28.3|233/0|d.151.1.1|1/1|DNase I-like| OP:NHOMO 148 OP:NHOMOORG 114 OP:PATTERN -----------------------------11------------------------------------- -------1--------------------------------------1--33---------------11--------------1-----2121-4-----111-111-1-2--------------------------------------1---1--------------------------------------------------------1------------1--11111--1--------------------1-------------------------------------------------------------------------1-------1-1-----1111----------------------------1-11-----------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------11--------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1111111111-------------------------------------------------------------1- ----11--------1--------1-11111111-11----------11--2222222-1211-11----2--311------111-----121--1--111-21112---1------------------------------------------------------------------------------1-----5234- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 84.5 SQ:SECSTR ##############################################EEEEEEEEEcTTTcTTccHHHHHHHHHHccTTccccEEEEEEEccHHHHHHHHHHTccEEcccTTccccTTccEEEEcccTTcccccccEEEEcccEEEEEEEEccccccccEEEEEEEEEEEETTEEEEEEEEEcccHHHHHHHHHHHHHHHHHHTccTTccEEEEEEcccccTTTTTcTTcHHHHHHHHHTccccEEEEccHHHHHHcTTccccccEEEEEcTTcccccEEETTEEEEEccccccccEEEEEEc# DISOP:02AL 1-9, 35-43| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHcccccEEEEcccccccccEEEEEEcccccEEEEccEEEEccccccccccccccccccEEEEEEEEEEccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHccccccHHHHccccccccccccccccccccccEEEEEEEcccccEEEEEcccccccccccccccEEEEEEEEc //