[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69194.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69194.1 GT:GENE BAC69194.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1828015..1828431 GB:FROM 1828015 GB:TO 1828431 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69194.1 LENGTH 138 SQ:AASEQ MDIDVRGPRFGAAVTTVVLAVVLITGSAWLLAWQTLAFALGAAGGAGRSPYGWLFRKVVRPRLGPPTEFEAPDPPRFAQTVGLGFAAVGLVGYTVGPPWLGLAATGCALAAAFLNAAFGYCLGCELYLLVRRVTVRAE GT:EXON 1|1-138:0| TM:NTM 3 TM:REGION 18->40| TM:REGION 76->98| TM:REGION 107->129| SEG 12->23|aavttvvlavvl| SEG 36->47|lafalgaaggag| SEG 81->92|vglgfaavglvg| SEG 100->119|lglaatgcalaaaflnaafg| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------------11-----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 137-138| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //