[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69197.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   16->144 3d9wC PDBj 2e-07 13.2 %
:RPS:SCOP  14->160 1e2tA  d.3.1.5 * 6e-10 15.1 %
:HMM:SCOP  35->141 1x3zA1 d.3.1.4 * 1.5e-13 32.7 %
:HMM:PFM   38->114 PF01841 * Transglut_core 4.6e-12 30.3 76/113  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69197.1 GT:GENE BAC69197.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1830057..1830656) GB:FROM 1830057 GB:TO 1830656 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69197.1 LENGTH 199 SQ:AASEQ MVAFLCSAGMELTQETPDLSAYLAAGEVIDHHHPRVRETAARLAEQAVDSYAYARSAYEFVRDAIPHSADSGDLRVTWRASDVLAEGTGICHAKAHALAALLRAEDIPTALCYQKLDLVHGLVAVRFDGAWHRQDPRGNKPGVDARFSLDGERLAFTPDPESNELDYPVLYAEPHPAVLGALQAAHDRPHLWKTLPTAL GT:EXON 1|1-199:0| SEG 92->104|hakahalaallra| RP:PDB:NREP 1 RP:PDB:REP 16->144|3d9wC|2e-07|13.2|121/282| HM:PFM:NREP 1 HM:PFM:REP 38->114|PF01841|4.6e-12|30.3|76/113|Transglut_core| RP:SCP:NREP 1 RP:SCP:REP 14->160|1e2tA|6e-10|15.1|139/274|d.3.1.5| HM:SCP:REP 35->141|1x3zA1|1.5e-13|32.7|101/0|d.3.1.4|1/1|Cysteine proteinases| OP:NHOMO 37 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------1-1-1-1111--------------- -------------------------------------------------------------------111-----1-------------------------------------------------------------------------1-----11-------1---------------------------------------------1---------------------1---------------------------------------------------------------------------------------------------------------------------1-1----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-1-11-1--------1-----------------------133-----1------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 88.4 SQ:SECSTR #########GcccccGccHHHHHHHHTccccccccH########HHHHHHHHHHHTTcccccHHHHTTccccccHHHHHHHHTcccccccHHHHHHHHHHHHHHTTcEEEEEEEEEcTEEEEEEcccccccEEEccccccccccccEEccccccEEETTEcEEEEEccTTcEEEEEEcccEEEEEccccccHH###### DISOP:02AL 199-200| PSIPRED cEEEEEccccHHHHcccccHHHHccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcEEEccccccccccccHHHHHHccccccHHHHHHHHHHHHHcccccEEEEccccEEEEEEEEEEccEEEEEEEccccccccccccccHHHHHccccccccccccccccccccHHHHHHHHHcccHHHHHHHccccc //