[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69200.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.29.1
:465 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   405->461 2vbiA PDBj 4e-04 46.4 %
:RPS:SCOP  212->322 1i3qB  e.29.1.1 * 1e-04 19.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69200.1 GT:GENE BAC69200.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1832569..1833966) GB:FROM 1832569 GB:TO 1833966 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69200.1 LENGTH 465 SQ:AASEQ MTEILVQERSEEQVPPQVRVVEHPAWPVLKDAVEQIRPWQSKDGSIDFEAEGAPDASDAELAVRRAIDAVEELSPLLPHDAAYHAALVKDLRRWSDDGFKVPDFLDSLLAFQPAGHRRDGLQHLVVFPMYTQNGNPDRNFEAVVLRMVWPDWLAELEATRYDNPLFCGITFEDFTAGYDTNSAVLFPETIAVREAPERFSWGGIFCDREAARFRAVTDAAVDTLGLELPADIAAMVHDQQRCEQAFVLWDMVHDRTHSHGDLPFDPFMIKQRQPFWMYGLEELRCDLTAFKEAVKLEADGFPQGRDVQYAVLFDRMFRFPVTGERVRNYDGLGGQLLFAYLHKHDVVRWTDNKLHIDWQRAPQVTNELCAEIEDLYRAGIDRPKLVHWFKAYELVSTYLAPHPGSRWAKGPDALDLTQPPRKLVDDVLPDEFPLSMFYEALAKKLKNVIASTKGITATSAERAAA GT:EXON 1|1-465:0| SEG 11->22|eeqvppqvrvve| BL:PDB:NREP 1 BL:PDB:REP 405->461|2vbiA|4e-04|46.4|56/554| RP:SCP:NREP 1 RP:SCP:REP 212->322|1i3qB|1e-04|19.8|111/1083|e.29.1.1| OP:NHOMO 15 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------------------111112-11---------111---------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 56 STR:RPRED 12.0 SQ:SECSTR ####################################################################################################################################################################################################################################################################################################################################################################################################################TcccccTTEE#EEcccEEEETTEEEEcccHHHHHHHHHHHcccccHHccccccccTT#### DISOP:02AL 459-465| PSIPRED cccEEEEEccccccccHHHEEcccccHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccEEEEEEEEEccccccccccEEEEEEEccHHHHHHHHHHccccccccEEEEEcccccccccEEEEccccHHHHcccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHEEcccEEEEcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccHHccc //