[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69201.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->116 1e8mA PDBj 3e-05 14.4 %
:RPS:SCOP  2->145 1evqA  c.69.1.2 * 1e-04 24.0 %
:RPS:PFM   91->117 PF07859 * Abhydrolase_3 5e-04 66.7 %
:HMM:PFM   90->117 PF07859 * Abhydrolase_3 1.8e-06 46.4 28/211  
:BLT:SWISS 3->63 GPDA_SYMTH 4e-04 40.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69201.1 GT:GENE BAC69201.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1834048..1834539) GB:FROM 1834048 GB:TO 1834539 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69201.1 LENGTH 163 SQ:AASEQ MGPRPTAARAVQPVRVTPGWARHAEVDRGRGHAPGMKLTNGHMACAPGMFGSSGGDFMPPADAVKEHSPDLGGSVADGRGPPAPSRRVGDLAYAAKLRVTGVPVTCSRYPAMLHGFLGLAEPLAEPLAEPVADARDAQRSIAEVVASTVSGRKKSGEGGGEAG GT:EXON 1|1-163:0| BL:SWS:NREP 1 BL:SWS:REP 3->63|GPDA_SYMTH|4e-04|40.7|59/100| SEG 119->130|laeplaeplaep| SEG 150->162|sgrkksgegggea| RP:PDB:NREP 1 RP:PDB:REP 4->116|1e8mA|3e-05|14.4|111/710| RP:PFM:NREP 1 RP:PFM:REP 91->117|PF07859|5e-04|66.7|27/205|Abhydrolase_3| HM:PFM:NREP 1 HM:PFM:REP 90->117|PF07859|1.8e-06|46.4|28/211|Abhydrolase_3| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF07859|IPR013094| GO:PFM GO:0016787|"GO:hydrolase activity"|PF07859|IPR013094| RP:SCP:NREP 1 RP:SCP:REP 2->145|1evqA|1e-04|24.0|129/308|c.69.1.2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 72.4 SQ:SECSTR HHHGccEEEEEcccccccTTTGGGcTTGGGGHHHHccTTcHHHHHHHHHHcGGGcccccccTTccccEEEEEEETTcccccTHHHHHHHHHHHTTTcTTccccEEEEEEccccccTcc############################################# DISOP:02AL 1-6, 72-74, 76-79, 147-163| PSIPRED ccccccHHHccccEEcccccHHHcccccccccccccEEccccEEEcccccccccccccccHHHHHHccccccccccccccccccccHHHHHHHHHHEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //