[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69204.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->117 2qntA PDBj 3e-06 29.4 %
:RPS:PDB   11->123 3bqxA PDBj 6e-14 23.0 %
:RPS:SCOP  11->116 2pjsA1  d.32.1.2 * 2e-15 26.5 %
:HMM:SCOP  4->120 1ecsA_ d.32.1.2 * 4.4e-21 36.6 %
:RPS:PFM   11->113 PF00903 * Glyoxalase 4e-07 37.6 %
:HMM:PFM   11->113 PF00903 * Glyoxalase 2.3e-14 30.1 103/128  
:BLT:SWISS 59->110 YSFE_BACSU 4e-04 30.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69204.1 GT:GENE BAC69204.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1835957..1836349 GB:FROM 1835957 GB:TO 1836349 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC69204.1 LENGTH 130 SQ:AASEQ MVHVLSSRTLLRPTDPERSRAFYGEKLGLAVYREFGTGPERGTVYFLGGGFLEVAGRSDSPPSPALKLWLQVPDAGTVHEELKNAGVEIVRPPVREPWGLIEMWIADPDGTEIVLVEIPADHPLRYRPGI GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 59->110|YSFE_BACSU|4e-04|30.8|52/80| BL:PDB:NREP 1 BL:PDB:REP 15->117|2qntA|3e-06|29.4|102/124| RP:PDB:NREP 1 RP:PDB:REP 11->123|3bqxA|6e-14|23.0|113/136| RP:PFM:NREP 1 RP:PFM:REP 11->113|PF00903|4e-07|37.6|101/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 11->113|PF00903|2.3e-14|30.1|103/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 11->116|2pjsA1|2e-15|26.5|102/111|d.32.1.2| HM:SCP:REP 4->120|1ecsA_|4.4e-21|36.6|112/0|d.32.1.2|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- --------------11111-11111111111111111111-11----------------------1111-1--------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 93.8 SQ:SECSTR ########EEEEEccHHHHHHHHHHTccccccEEcccEEEEEcccEEEEEEHHHHHHHHccccccEEEEcccGGGHHHHHHHHHTTcEEEEEEEccTTccEEEEEEcTTccEEEEEEcTTccEccccEEc DISOP:02AL 1-3, 124-125, 129-130| PSIPRED cEEEEcEEEEEEEccHHHHHHHHHHHcccEEHHHcccccccEEEEEEcccEEEEEEcccccccccEEEEEEEccHHHHHHHHHHcccEEEEcccccccccEEEEEEcccccEEEEEEEcccccccccccc //