[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69205.1
DDBJ      :             putative hydroxylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  120/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:254 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   13->253 1dhyA PDBj 4e-17 13.9 %
:RPS:SCOP  1->248 1sp9A  d.32.1.3 * 5e-12 10.1 %
:HMM:SCOP  8->129 1q0oA2 d.32.1.3 * 1.9e-24 31.9 %
:HMM:SCOP  137->248 2i7rA1 d.32.1.2 * 7.9e-19 32.4 %
:HMM:PFM   15->121 PF00903 * Glyoxalase 3.4e-11 21.5 107/128  
:HMM:PFM   139->245 PF00903 * Glyoxalase 5.4e-10 24.3 107/128  
:BLT:SWISS 9->247 CF30_MYCTU 3e-31 40.7 %
:REPEAT 2|9->119|137->245
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69205.1 GT:GENE BAC69205.1 GT:PRODUCT putative hydroxylase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1836411..1837175 GB:FROM 1836411 GB:TO 1837175 GB:DIRECTION + GB:PRODUCT putative hydroxylase GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC69205.1 LENGTH 254 SQ:AASEQ MKLDRPVTGGPCWTELGTSDLEAAKRFYTDLFGWRLETDPRQEAGGYTVAHLGDAAVAAISPRYEESQPVAWNVSFSVADADAAVATVRDAGGTVVLGPMDVFDVGRFAVASDPGGAAFQLWQPRAFPGAGLFNAPGSLGWVELLTRAAEQATAFYTTVFGWSVNASEHYTQWGVGGADFGGMVTMDEQFPPQVPSHWLPYFAVEDVDATAHDATEAGGSVLMEPTSVPDGPRIAVLRDAQGAAFGIHVGGEEG GT:EXON 1|1-254:0| BL:SWS:NREP 1 BL:SWS:REP 9->247|CF30_MYCTU|3e-31|40.7|236/261| NREPEAT 1 REPEAT 2|9->119|137->245| SEG 78->96|vadadaavatvrdaggtvv| RP:PDB:NREP 1 RP:PDB:REP 13->253|1dhyA|4e-17|13.9|238/278| HM:PFM:NREP 2 HM:PFM:REP 15->121|PF00903|3.4e-11|21.5|107/128|Glyoxalase| HM:PFM:REP 139->245|PF00903|5.4e-10|24.3|107/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->248|1sp9A|5e-12|10.1|248/362|d.32.1.3| HM:SCP:REP 8->129|1q0oA2|1.9e-24|31.9|119/0|d.32.1.3|1/2|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| HM:SCP:REP 137->248|2i7rA1|7.9e-19|32.4|111/0|d.32.1.2|2/2|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 184 OP:NHOMOORG 120 OP:PATTERN -------------------------------------------------------------------- -11-31111111111--22-21--212222211---2133-111--12----423-12--221-235577------------1---------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------1-1----------11111111111---2--1-1111-111-1111111111-----1--1---1---------22---1-------------------------------1-11---------------------------------------1-----------------------------------------------111----------1-------------------------------1----1----1222211122211212122---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 254 STR:RPRED 100.0 SQ:SECSTR cccccccEEEEEEEEEEEccHHHHHHHHHHTTccEEEEEETTEEEEEEEEcccccccEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHTTcccEEccHHHHHccEEEEEEcGGGcEEEEEEcccccTTccccccccccEEEEEcccHHHHHHHHHHTcccEEEEEEEccEEEEEEcccccccEEcccccccEEEEEEEcccHHHHHHHHHHHHHTTcEEEEEEEEcccccEEEEEEcccTTcEEEEEEcccG DISOP:02AL 1-4, 252-254| PSIPRED ccccccccccEEEEEEEcccHHHHHHHHHHHcccEEEEccccccccEEEEccccccEEEcccccccccccccEEEEEcccHHHHHHHHHHcccEEEEcccccccccEEEEEEEccccEEEEEccccccccccccccccEEEEEEEcccHHHHHHHHHHHcccEEcccccEEEEEcccccccEEEEccccccccccccEEEEEEEccHHHHHHHHHHcccEEEEcccccccccEEEEEEcccccEEEEEEccccc //