[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69209.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->82 PF04600 * DUF571 9.4e-07 32.9 79/425  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69209.1 GT:GENE BAC69209.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1840223..1840771 GB:FROM 1840223 GB:TO 1840771 GB:DIRECTION + GB:PRODUCT putative integral membrane protein GB:PROTEIN_ID BAC69209.1 LENGTH 182 SQ:AASEQ MHGSASPGWLLVALCAATGTYCLLRMRSGVEEQRRAAGGEALMGFGMAAMAVPAAVAAPPRWAWLAYAVVFGAAGVRALWGAQTGAHHLHHLVGAFAMAYMAGVMAASPAHHEHGAASGLPPVTGVLLLYFAGYVLWSGVRLIPVASVAGGGRSVGWGDRPELARACRLSMGIAMVAMLLTL GT:EXON 1|1-182:0| TM:NTM 6 TM:REGION 5->25| TM:REGION 37->58| TM:REGION 63->85| TM:REGION 87->108| TM:REGION 125->147| TM:REGION 161->182| SEG 47->60|maamavpaavaapp| SEG 145->158|vasvagggrsvgwg| HM:PFM:NREP 1 HM:PFM:REP 4->82|PF04600|9.4e-07|32.9|79/425|DUF571| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 29-39| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccccccHHHHHHHHHHHHHHHHHHcHHHEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHcc //