[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69210.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:311 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   142->272 3c37B PDBj 1e-09 21.1 %
:RPS:PFM   142->204 PF01435 * Peptidase_M48 3e-04 38.1 %
:HMM:PFM   116->203 PF01435 * Peptidase_M48 1.3e-11 31.3 83/225  
:BLT:SWISS 142->271 HTPX_RALSO 4e-05 31.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69210.1 GT:GENE BAC69210.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1840948..1841883 GB:FROM 1840948 GB:TO 1841883 GB:DIRECTION + GB:PRODUCT putative integral membrane protein GB:NOTE PF01435: Peptidase family M48 GB:PROTEIN_ID BAC69210.1 LENGTH 311 SQ:AASEQ MMVPAALLLLGALTAVVAPRLLALADWPDREPVVALWVWQCVVAAVLVCCALSMTLSAAAAWVAVRGHVFAGAPHPVVEAYALSTGGSWASTTAVMLAGGGVWSAAMLVREIARARARRRQRRAELLVRAPLLPGEEPGADRLVVLEGERPDAWWLPGAAPQLVITTAALRRLKGRQLDAVLAHEQGHAQARHDWLLHCSGALAGGFPQVPVFAAFRDEMHRLVELAADDVASRRFGRLTIALALVELNEDRGVFGPCPTPQAHVPQRVHRLLTPPDRLTAARRLQLTAAAALVPVIPVLVAFVPGLRALG GT:EXON 1|1-311:0| BL:SWS:NREP 1 BL:SWS:REP 142->271|HTPX_RALSO|4e-05|31.8|129/286| TM:NTM 4 TM:REGION 4->26| TM:REGION 40->62| TM:REGION 93->114| TM:REGION 287->309| SEG 5->18|aallllgaltavva| SEG 33->52|vvalwvwqcvvaavlvccal| SEG 109->130|vreiarararrrqrraellvra| SEG 278->305|rltaarrlqltaaaalvpvipvlvafvp| RP:PDB:NREP 1 RP:PDB:REP 142->272|3c37B|1e-09|21.1|123/216| RP:PFM:NREP 1 RP:PFM:REP 142->204|PF01435|3e-04|38.1|63/208|Peptidase_M48| HM:PFM:NREP 1 HM:PFM:REP 116->203|PF01435|1.3e-11|31.3|83/225|Peptidase_M48| GO:PFM:NREP 3 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF01435|IPR001915| GO:PFM GO:0006508|"GO:proteolysis"|PF01435|IPR001915| GO:PFM GO:0016020|"GO:membrane"|PF01435|IPR001915| OP:NHOMO 32 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ----3----------------7---1-----13-121111---21--1---1---------------122----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 40.2 SQ:SECSTR #############################################################################################################################################EEEEEccccccEEEETTTETEEEEEHHHHHHcccHHHHHHHHHHHHHHHTTHHHHHHHHHHHccHHHHHHHHHcTTccccHHHHHHHHHHHHHHHHTTccTTHHHHHHHH##HTcccccc####HHHHHHH####################################### DISOP:02AL 311-312| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccEEEEcccccEEEEEHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccc //