[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69211.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.111.1
:227 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   40->199 2a96B PDBj 3e-06 14.3 %
:HMM:SCOP  9->221 1d2tA_ a.111.1.1 * 2.2e-32 33.7 %
:HMM:PFM   102->218 PF01569 * PAP2 9.4e-27 38.6 114/129  
:HMM:PFM   8->42 PF04600 * DUF571 0.00038 37.1 35/425  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69211.1 GT:GENE BAC69211.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1841987..1842670 GB:FROM 1841987 GB:TO 1842670 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01569: PAP2 superfamily GB:PROTEIN_ID BAC69211.1 LENGTH 227 SQ:AASEQ MHSPPVGSPPRPPRPRAAARAVVVLAAASALVVLLVALPWQPLIALDGDISRATHRWAVDEPGVTHAFRILTDWVWDPLTMRLACAAAVVWLVWRHSAWRLALWVAAACALGTLLQQVLKAAVDRARPVWPDPVDSAHYTAFPSGHAMTATVVCGLLLWLLRLYGAGRALWRTGVALAAVSVVGVGLTRVWLGVHWPSDVLGGWLLGALVVAGAMASYGRWHGSGPA GT:EXON 1|1-227:0| TM:NTM 5 TM:REGION 23->45| TM:REGION 88->110| TM:REGION 145->167| TM:REGION 169->191| TM:REGION 196->217| SEG 3->39|sppvgspprpprpraaaravvvlaaasalvvllvalp| SEG 83->94|lacaaavvwlvw| SEG 155->172|glllwllrlygagralwr| SEG 174->187|gvalaavsvvgvgl| SEG 200->216|vlggwllgalvvagama| RP:PDB:NREP 1 RP:PDB:REP 40->199|2a96B|3e-06|14.3|147/219| HM:PFM:NREP 2 HM:PFM:REP 102->218|PF01569|9.4e-27|38.6|114/129|PAP2| HM:PFM:REP 8->42|PF04600|0.00038|37.1|35/425|DUF571| HM:SCP:REP 9->221|1d2tA_|2.2e-32|33.7|199/224|a.111.1.1|1/1|Acid phosphatase/Vanadium-dependent haloperoxidase| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------112----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 70.0 SQ:SECSTR #######################################TcHHHHHHHHHHHHHHTTTT#TcHHHHHHHHHTccccHHHHHHHHHHHHTccccTTTcHHHHHHHHHHHHHHHTTTTHHHHHHHccccHHHHTTcccccGGccccHHHHHHHHHHHHHHHHcGGGHHHHHHcGGGHHHHHHHHHHHHHHHHHTTcccHHH############################ DISOP:02AL 1-10, 224-227| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccc //