[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69215.1
DDBJ      :             putative lipoprotein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:239 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   120->235 3bt5A PDBj 4e-09 33.9 %
:RPS:PDB   93->232 3bt5A PDBj 2e-10 27.5 %
:RPS:PFM   100->149 PF03713 * DUF305 2e-07 46.0 %
:RPS:PFM   187->236 PF03713 * DUF305 8e-08 44.0 %
:HMM:PFM   98->149 PF03713 * DUF305 8.1e-20 42.3 52/53  
:HMM:PFM   187->237 PF03713 * DUF305 1.4e-18 37.3 51/53  
:HMM:PFM   26->71 PF05481 * Myco_19_kDa 0.00067 34.8 46/160  
:BLT:SWISS 47->79 MDC1_RAT 2e-04 51.5 %
:BLT:SWISS 187->238 YL153_MIMIV 8e-05 32.7 %
:REPEAT 2|83->145|172->235
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69215.1 GT:GENE BAC69215.1 GT:PRODUCT putative lipoprotein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1845876..1846595 GB:FROM 1845876 GB:TO 1846595 GB:DIRECTION + GB:PRODUCT putative lipoprotein GB:NOTE PF03713: Domain of unknown function (DUF305) GB:PROTEIN_ID BAC69215.1 LENGTH 239 SQ:AASEQ MRRSTGGNVLVTNVPDPSRALNSRVRQMTWATVSLAVVALALSGCDSGSDSPTDVKSGAASGPSVIVPGKPGDANETLSAEDAAKRRTDDDSPNTADFSYARMMIEHHTQALEMTELAPKRAESGKVKRLAERIAAAQGPEIASMEAWLKSHGGERKSTSHAHDTMPGMASAAQLKTLRAAKGRAFDELFLTLMITHHDGAITMATEVKSQGNNIQIEEMADDVIAQQTSELGRMRDLP GT:EXON 1|1-239:0| BL:SWS:NREP 2 BL:SWS:REP 47->79|MDC1_RAT|2e-04|51.5|33/100| BL:SWS:REP 187->238|YL153_MIMIV|8e-05|32.7|52/152| NREPEAT 1 REPEAT 2|83->145|172->235| SEG 33->43|vslavvalals| BL:PDB:NREP 1 BL:PDB:REP 120->235|3bt5A|4e-09|33.9|112/151| RP:PDB:NREP 1 RP:PDB:REP 93->232|3bt5A|2e-10|27.5|138/151| RP:PFM:NREP 2 RP:PFM:REP 100->149|PF03713|2e-07|46.0|50/53|DUF305| RP:PFM:REP 187->236|PF03713|8e-08|44.0|50/53|DUF305| HM:PFM:NREP 3 HM:PFM:REP 98->149|PF03713|8.1e-20|42.3|52/53|DUF305| HM:PFM:REP 187->237|PF03713|1.4e-18|37.3|51/53|DUF305| HM:PFM:REP 26->71|PF05481|0.00067|34.8|46/160|Myco_19_kDa| OP:NHOMO 107 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- --1-----11----1------4---1------41334333-11121---1--425-11--332-3-33211-----------1----------------1------1--------------------------------1----1----1---1-11-------2---21-------------21--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4-----------------------------------------1-1--------------------1--------------------------------------------------------1----1--------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------11------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 59.0 SQ:SECSTR ############################################################################################ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccccHHHHHHTTcccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHGGGGcc##cHHHHHHHHHHHHHHHHHHHHH#### DISOP:02AL 1-6, 49-94, 150-183| PSIPRED ccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcc //