[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69216.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69216.1 GT:GENE BAC69216.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1846605..1847069) GB:FROM 1846605 GB:TO 1847069 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69216.1 LENGTH 154 SQ:AASEQ MSVRRAWEVREHEVTTSWFDVCLAFADGARVDVLAVLAEGGVFVEDVRAQPPLSLDDLTALADWIEGPLFEACGGEPGPSGEPEEASSRHARPAWPRGIEGRRLVAEEYLAAQGEGIDPVLAVMCATGHSRRRALRLIAGARDAGFLTPRHVRR GT:EXON 1|1-154:0| SEG 74->88|ggepgpsgepeeass| SEG 131->145|rrralrliagardag| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 77-96, 151-154| PSIPRED ccccEEEEEEcccEEEHEEEEEEEEcccccEEEEEEEccccEEEEEEcccccccHHHHHHHHHHHccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHcccccccccHHccc //