[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69222.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:209 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->204 PF12158 * DUF3592 4.3e-05 19.8 111/148  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69222.1 GT:GENE BAC69222.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1852830..1853459) GB:FROM 1852830 GB:TO 1853459 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69222.1 LENGTH 209 SQ:AASEQ MSAFRGPQAWRSRWRRKPLARWRRNPLWRWRRNQLRRRSDVLEAWVLFSAWTVTVLCGVLTGLAAAHSVEQGLARERAEWRPVRALVAEDAPESSAAASSGADRVWAKVRWTTANGSTHSGQARVAAGSATGTPVTVWTDRDGLLVTKPVPPSEAQVRGVTVGLLVGVSAAAGPFVGGRLVRGRLERRRMERWDEDWARFGPMWGRKTG GT:EXON 1|1-209:0| TM:NTM 1 TM:REGION 42->64| SEG 10->38|wrsrwrrkplarwrrnplwrwrrnqlrrr| SEG 88->103|aedapessaaassgad| SEG 159->173|gvtvgllvgvsaaag| SEG 176->192|vggrlvrgrlerrrmer| HM:PFM:NREP 1 HM:PFM:REP 50->204|PF12158|4.3e-05|19.8|111/148|DUF3592| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19, 89-105, 205-209| PSIPRED ccccccccccccccccccHHHccccccHHHHcccccccccEEEEEEEEcccEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccEEEEEEEccccccEEEEEEcccccccccEEEEEEccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //