[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69223.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.68.1b.69.13
:380 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->377 3b7fA PDBj 3e-58 41.7 %
:RPS:PDB   52->326 3a0fA PDBj 1e-28 24.4 %
:RPS:SCOP  60->372 1sntA  b.68.1.1 * 2e-09 13.0 %
:HMM:SCOP  23->380 1sqjA2 b.69.13.1 * 2.3e-55 32.3 %
:HMM:PFM   84->94 PF02012 * BNR 0.0007 45.5 11/12  
:BLT:SWISS 246->366 YC48L_SYNPX 4e-04 31.7 %
:REPEAT 5|48->99|167->210|218->264|274->319|322->369
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69223.1 GT:GENE BAC69223.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1853697..1854839 GB:FROM 1853697 GB:TO 1854839 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF02012: BNR/Asp-box repeat GB:PROTEIN_ID BAC69223.1 LENGTH 380 SQ:AASEQ MVGCRLARIWNNVVAEVAAMAEVLLTVGTRKGLFVGRRRGGAWEFDESPYFNAQAVYSVAIDTRDKAPRLLVGGDSAHWGPSVFHSDDLGRTWTEPPQPAVKFPKDTGASLERVWQLHPAAAEPDVVYAGTEPAALYRSEDRGESFRLVRPLWEHPTRDRWVPGGGGEGLHTVITDKRDPSAVTVAVSTAGVFRTHDGGASWAPSNSGVSAVFLPDPNPEFGQCVHKIAQDAATPDRLYLQNHWGVYRSDDAGGHWTDIGEGLPSTFGFAAAAHPHRGDTAYVFPINADADRVPADRRCRVFRTADAGESWEPLTAGLPDEDHYGTVLRDALCTDDADPAGVYFGNRNGEVYASADDGDSWRQLASHLPDVLCVRAAVVG GT:EXON 1|1-380:0| BL:SWS:NREP 1 BL:SWS:REP 246->366|YC48L_SYNPX|4e-04|31.7|101/100| NREPEAT 1 REPEAT 5|48->99|167->210|218->264|274->319|322->369| SEG 13->23|vvaevaamaev| SEG 181->190|savtvavsta| BL:PDB:NREP 1 BL:PDB:REP 43->377|3b7fA|3e-58|41.7|324/358| RP:PDB:NREP 1 RP:PDB:REP 52->326|3a0fA|1e-28|24.4|262/753| HM:PFM:NREP 1 HM:PFM:REP 84->94|PF02012|0.0007|45.5|11/12|BNR| RP:SCP:NREP 1 RP:SCP:REP 60->372|1sntA|2e-09|13.0|299/352|b.68.1.1| HM:SCP:REP 23->380|1sqjA2|2.3e-55|32.3|313/0|b.69.13.1|1/1|Oligoxyloglucan reducing end-specific cellobiohydrolase| OP:NHOMO 106 OP:NHOMOORG 84 OP:PATTERN ------------------------1--1---------------------------------------- 325-----------------------------------111-----------111-------1---1111-------------------------------------------------------------------11-2----1------------------------------------------------22222111-112112------111----1-------------------------1----------------------------------------------------------------------------------------------------------------------------2-----1-------------------------------------------------------1-----------------------------------------------------------------11--1221111----11--------12-1211----211-----21----1--1-------------11-----------------1----1--1111-1-1------------------------------1------------------------------1-1--------------------------------------------------------------------------------------------------------1-----------------------------1111-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 352 STR:RPRED 92.6 SQ:SECSTR ##########################EEETTEEEEEEEcTcccEEEEEEEcccccEEEEEccTTcTTcEEEEEcccTTTccEEEEEccTTcccEEEEccccccTTcTTTTccccEEEcTcTTcTTcEEEEcccccEEEEccTTcccEEcTTccccccTHHHcccccTTcEEEEEEccccTcEEEEEccTTcEEEEcccccccccccccHHHHHHHHHHcccccccEEEEEEEcTTccEEEcccEEEEEEETTTTEEEEccGcTTTcccccEEccccccTTccccEEEEEEEccTcTTcccEEEEccTTccEEEHHHHHccTTccccccTccEEEcccccccEEEEcTTccEEEEccTTcccEEEEcccccEEEEEEEc## DISOP:02AL 1-2| PSIPRED ccccEEEEEcccccEEEEEEccEEEEEEccccEEEEEcccccccccccccccccccEEEEEEcccccEEEEEEEcccccccEEEEEEcccccccccccccccccccccccccEEEEEEEEcccccEEEEEEcccEEEEEccccccEEEcccccccccccccccccccccEEEEEEEcccccEEEEEEcccEEEEEccccccEEEcccccccccccccccccccccEEEEEEcccccEEEEEcccEEEEEEcccccccccccccccccEEEEEEccccccEEEEEEEccccccccccccEEEEEEEccccccEEccccccccccccccEEEEEEEccccccEEEEEEcccEEEEEEccccccEEEccccccEEEEEEEEEc //