[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69225.1
DDBJ      :             putative transport integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:361 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->152 PF03547 * Mem_trans 8.2e-16 16.3 141/385  
:HMM:PFM   217->356 PF03547 * Mem_trans 4.1e-11 19.7 137/385  
:BLT:SWISS 5->158 YWKB_BACSU 5e-17 40.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69225.1 GT:GENE BAC69225.1 GT:PRODUCT putative transport integral membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1856893..1857978 GB:FROM 1856893 GB:TO 1857978 GB:DIRECTION + GB:PRODUCT putative transport integral membrane protein GB:NOTE PF03547: Auxin Efflux Carrier GB:PROTEIN_ID BAC69225.1 LENGTH 361 SQ:AASEQ MDPAMSFAEIFTVVVPVFLVIAVGYGTGRRALFDAGGAQALRELTMQLALPAALLLSIWQTPRRVLVEQLPLVGLLAFGLLGVYAVLLGVLRLAGRRPLRRAALFALACVQPQYAFMGTSILGGLFGTAQAAVPIAVAGILVNVVLDPVVLILLGMPEHPASRTAATAAAATSAVRRPALVTVGGGAPGESVEAAAPVAAGDASPEHRPSVLRTVGHALREPFCWGPVLGLILSVGGVGVPKVAGTSLTLLAGAASAAALLYVGVSVSRIGRPKLTPAVWAIALTSVVVLPLLVYGAGLAMASAADAAQAALIVAFPVSPVPLMFAARHGSKADVRTIGSAVVLSLLLSFVTLPLLIELIG GT:EXON 1|1-361:0| BL:SWS:NREP 1 BL:SWS:REP 5->158|YWKB_BACSU|5e-17|40.9|154/319| TM:NTM 9 TM:REGION 5->27| TM:REGION 41->62| TM:REGION 69->91| TM:REGION 127->149| TM:REGION 222->244| TM:REGION 247->269| TM:REGION 278->300| TM:REGION 308->329| TM:REGION 337->359| SEG 70->108|lplvgllafgllgvyavllgvlrlagrrplrraalfala| SEG 160->179|pasrtaataaaatsavrrpa| SEG 183->206|vgggapgesveaaapvaagdaspe| SEG 228->240|vlglilsvggvgv| SEG 244->261|agtsltllagaasaaall| SEG 297->315|aglamasaadaaqaaliva| SEG 340->356|savvlslllsfvtlpll| HM:PFM:NREP 2 HM:PFM:REP 10->152|PF03547|8.2e-16|16.3|141/385|Mem_trans| HM:PFM:REP 217->356|PF03547|4.1e-11|19.7|137/385|Mem_trans| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHc //