[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69228.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69228.1 GT:GENE BAC69228.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1860949..1861248) GB:FROM 1860949 GB:TO 1861248 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69228.1 LENGTH 99 SQ:AASEQ MIIFGTRGYLYQLAMLTLVCGRCGNPSAHTLRKRVTKFTLFFVPLFPFSTKYTTQCTFCGAEQKVTKEQAERLQAQGAHGHGGQTYGQQSQQPQQPYQS GT:EXON 1|1-99:0| TM:NTM 2 TM:REGION 2->24| TM:REGION 39->61| SEG 74->98|qaqgahghggqtygqqsqqpqqpyq| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------11-------------1-1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 65-99| PSIPRED cEEEcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHEccccccccccEEEEcccHHHHHHHHHHHHHHcccccccccccccccccccccccc //