[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69230.1
DDBJ      :             putative 1-aminocyclopropane-1-carboxylate deaminase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  226/915 : Eukaryota  62/199 : Viruses  0/175   --->[See Alignment]
c.79.1
:326 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->310 1tzkC PDBj 2e-41 38.5 %
:RPS:PDB   3->302 2c2gA PDBj 4e-25 17.5 %
:RPS:SCOP  4->312 1f2dA  c.79.1.1 * 8e-74 29.9 %
:HMM:SCOP  5->316 1rqxA_ c.79.1.1 * 6.8e-68 41.2 %
:HMM:PFM   9->301 PF00291 * PALP 1.2e-37 29.2 267/297  
:BLT:SWISS 4->313 1A1D_PYRFU 6e-49 37.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69230.1 GT:GENE BAC69230.1 GT:PRODUCT putative 1-aminocyclopropane-1-carboxylate deaminase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1862701..1863681 GB:FROM 1862701 GB:TO 1863681 GB:DIRECTION + GB:PRODUCT putative 1-aminocyclopropane-1-carboxylate deaminase GB:NOTE PF00291: Pyridoxal-phosphate dependent enzyme GB:PROTEIN_ID BAC69230.1 LENGTH 326 SQ:AASEQ MSDKIALSTWPTPLEPMPRLAAALGLGENDLWIKRDDLIGLGGGGNKVRKLEWTVGAALAAGADTLVTTGAAQSNHARLTAAAGARLGLDVVLVFPGTPDSATHGSGNLVLDSLFGARVHWAGDGGPSTMGDVADEVCRQLRRDGARPHLIPFGGSSPLGARGYVEGGEELRSQLPDVDHVVVALGSGGTMAGLVGALGEQRVLGVHCGAVAEPAATVADLAGPLTRRSITPESLRLRTDQVGAGYGVLHEPVLEAMRTAAGTEGIVLDPVYSGRAMAGLIAAVRDGDIRPAQRTVFLHTGGLPGLFGHTETVQRSVSTLRSYEVE GT:EXON 1|1-326:0| BL:SWS:NREP 1 BL:SWS:REP 4->313|1A1D_PYRFU|6e-49|37.8|299/329| SEG 77->89|arltaaagarlgl| BL:PDB:NREP 1 BL:PDB:REP 7->310|1tzkC|2e-41|38.5|301/335| RP:PDB:NREP 1 RP:PDB:REP 3->302|2c2gA|4e-25|17.5|285/447| HM:PFM:NREP 1 HM:PFM:REP 9->301|PF00291|1.2e-37|29.2|267/297|PALP| RP:SCP:NREP 1 RP:SCP:REP 4->312|1f2dA|8e-74|29.9|308/341|c.79.1.1| HM:SCP:REP 5->316|1rqxA_|6.8e-68|41.2|311/338|c.79.1.1|1/1|Tryptophan synthase beta subunit-like PLP-dependent enzymes| OP:NHOMO 356 OP:NHOMOORG 291 OP:PATTERN ------------------------------------------------------111----------- --------------1----------1-----------1------1-----1-----------2-1-11-1-----------------------1-----111-1--1--------------------------------------11------------------------------------1----------11111111-111111------111-------------1--------------------1-----------------------------------------------------------------------1---------------11-----------------2---1------------1111-------111-------1------------11111111-11-1--1-1-11-2-12---11-----2-2----------------------------------------------------11--111111122221113222212211-11---111-1211--2-1------------------------12-2--11-111-----------1111-2-1---------------------------11---21-311-------1------1-----------------2131-11121111-111-1111111111111-11--111111---1111111111111111111111111-111111111111---------------1-1-----------------1--1-11--------1111----1222---------1-------------------------------------------------------------------------------11111--- ------1---------1--22212221------111-111-11-----112343-1111111-1----------------------------1-2-1-----------2--------------------------------------------------111-11--------2--11-9111111111-12112322- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 310 STR:RPRED 95.1 SQ:SECSTR ccTccccccccccEEEcHHHHHHHHcccccEEEEETTccccccTHHHHHHHHHHHHHHHHTTccccEEEEccccHHHHHHHHHHHHHTccEEEEEETTTcGGGccTTTTHHHHHTTcEEEEEcccHTcccHHHHHHHHHHHHTTccEEEccTTcHHcHHHHHHHHHHHHHHHHHTTcccEEEEccccTHHHHHHHHHHHHHHHTTccccccTTcccHHHHHTTTTcccccHHHHHHHHHHTTcEEEEEcHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHTTcccTTccEEEEEcccGGGGGGGT################ DISOP:02AL 326-327| PSIPRED cccEEcccccccccEEHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHcccccccccHHHEEEEEcccccEEEccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHHHcccHHcccc //