[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69233.1
DDBJ      :             putative lyase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->139 1bylA PDBj 8e-12 17.8 %
:RPS:SCOP  1->147 1sp9A  d.32.1.3 * 8e-15 18.6 %
:HMM:SCOP  3->145 1q0oA2 d.32.1.3 * 2.4e-17 28.3 %
:HMM:PFM   8->135 PF00903 * Glyoxalase 3.3e-09 27.1 107/128  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69233.1 GT:GENE BAC69233.1 GT:PRODUCT putative lyase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1865337..1865780 GB:FROM 1865337 GB:TO 1865780 GB:DIRECTION + GB:PRODUCT putative lyase GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC69233.1 LENGTH 147 SQ:AASEQ MDMKLEIAVVPVADVDRAKDFYQALGWRLDADVADGEDFRVVQFTPPGSPCSIIFGTGVTSAAPGSTQGLHLIVSDIEAAHAELTDRGVKVSEVFHDASGVFHRAGNEGRVPGPDPERRSYASYLSFSDPDGNGWLLQEITERFPGR GT:EXON 1|1-147:0| RP:PDB:NREP 1 RP:PDB:REP 1->139|1bylA|8e-12|17.8|118/122| HM:PFM:NREP 1 HM:PFM:REP 8->135|PF00903|3.3e-09|27.1|107/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->147|1sp9A|8e-15|18.6|145/362|d.32.1.3| HM:SCP:REP 3->145|1q0oA2|2.4e-17|28.3|120/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 54 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- -11-2-------------------------------1232-----1-----1121--2--211----221------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3------------------------1------1------21133221------------------------------------------------------------------------------------11-----------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 100.0 SQ:SECSTR ccccccccEEEEccHHHHHHHHHHTccEEEEEcccEEEEEETTEEEEEEEcccTTTGGGcEEEEEEccHHHHHHHHHTTcccccccccccEEccccHHHHHTHHHHEEEEETTcccEEETTEEEEEEEcTTccEEEEEcccccccTT DISOP:02AL 144-147| PSIPRED ccEEEEEEEEEEccHHHHHHHHHHHccEEEEEEEccccEEEEEEEcccccEEEEEEccccccccccEEEEEEEEHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEccccccc //