[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69234.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  242/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->176 3bruB PDBj 3e-13 33.1 %
:RPS:PDB   6->179 3br2A PDBj 2e-20 21.0 %
:RPS:SCOP  3->76 3c07A1  a.4.1.9 * 1e-14 32.4 %
:RPS:SCOP  77->194 1sgmA2  a.121.1.1 * 4e-11 12.7 %
:HMM:SCOP  3->83 1t33A1 a.4.1.9 * 1.2e-16 40.0 %
:HMM:SCOP  77->195 1sgmA2 a.121.1.1 * 3e-16 32.4 %
:RPS:PFM   11->53 PF00440 * TetR_N 5e-06 53.5 %
:HMM:PFM   11->57 PF00440 * TetR_N 8.1e-18 51.1 47/47  
:HMM:PFM   127->173 PF11578 * DUF3237 0.00091 26.1 46/151  
:BLT:SWISS 6->184 YPB3_LACLA 8e-19 31.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69234.1 GT:GENE BAC69234.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1865838..1866458) GB:FROM 1865838 GB:TO 1866458 GB:DIRECTION - GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC69234.1 LENGTH 206 SQ:AASEQ MGRTSDAREKILTAAQSLIELRGYSALGTAEICKVAGVPKGSFYYFFESKEALALAVLDEHWATQRREWTRILSGEAEPLQRLRQLFEETEAGQRAGQQSCGTVSGCMFGNLTLEMSNQTEAIRERLQQIFDAQVDMVEEVIIGARERGEVAVSDTREGARSVVAQLEGQVLFAKLYNDTGRLKPLWTNCLAILGARMPEEVSAAN GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 6->184|YPB3_LACLA|8e-19|31.8|170/196| BL:PDB:NREP 1 BL:PDB:REP 7->176|3bruB|3e-13|33.1|163/186| RP:PDB:NREP 1 RP:PDB:REP 6->179|3br2A|2e-20|21.0|167/186| RP:PFM:NREP 1 RP:PFM:REP 11->53|PF00440|5e-06|53.5|43/47|TetR_N| HM:PFM:NREP 2 HM:PFM:REP 11->57|PF00440|8.1e-18|51.1|47/47|TetR_N| HM:PFM:REP 127->173|PF11578|0.00091|26.1|46/151|DUF3237| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 3->76|3c07A1|1e-14|32.4|74/75|a.4.1.9| RP:SCP:REP 77->194|1sgmA2|4e-11|12.7|110/111|a.121.1.1| HM:SCP:REP 3->83|1t33A1|1.2e-16|40.0|80/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 77->195|1sgmA2|3e-16|32.4|111/111|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 310 OP:NHOMOORG 245 OP:PATTERN --------------------------1-----------------------1----------------- 1-1-1----------22--------1-----------------1--------------------11-1-1-------------------------------------------------------------------11-1-----2--1----------------1111-----------------------1--------------------2--------------------------------------------------------------1--------------------------------------------------------------11-------------------------------1--1--------331---1----------------1-12-2221--11-211-132--3----------1-1----22222222-11--1-1------------------------------1----1--12423233-111111111111-112--131--111-1----1-1---1-111-1----------1-12-22---1--1---1--1-121111--------1------------------------11--1-112211111111-2-111--1-2-11----2-1------11---111111111111-1211111112111111111222-----1111111111111111-11111111-111111111111---1----------1--1-------------------1-1111222222--1311---1113-------------------11111----------------1------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 97.1 SQ:SECSTR cccHHcHHHHHHHHHHHHHHHHHHHHccHHHHHHHTTccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHGGGcccHHHHHHHHHHHHHHHHTTcTGccccTGTHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHTTTccccccHHHHHHHHHHHHHHHHHTTTTccHHHHHHHHHHHHGGGcTccHHH###### DISOP:02AL 1-5, 201-206| PSIPRED cccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHccc //