[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69236.1
DDBJ      :             putative LysR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  519/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:304 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->69 1iz1B PDBj 2e-09 39.1 %
:RPS:PDB   1->69 1b9nA PDBj 5e-19 17.6 %
:RPS:PDB   188->265 2d0qA PDBj 6e-06 17.6 %
:RPS:SCOP  2->69 1ixcA1  a.4.5.37 * 4e-18 49.2 %
:RPS:SCOP  98->280 2esnA2  c.94.1.1 * 7e-04 16.0 %
:HMM:SCOP  1->89 1ixcA1 a.4.5.37 * 2.6e-25 47.2 %
:HMM:SCOP  90->286 1ixcA2 c.94.1.1 * 1.2e-05 23.2 %
:RPS:PFM   3->61 PF00126 * HTH_1 2e-11 55.9 %
:HMM:PFM   3->61 PF00126 * HTH_1 2.3e-25 57.6 59/60  
:HMM:PFM   103->166 PF03466 * LysR_substrate 8.2e-07 24.6 61/209  
:HMM:PFM   244->282 PF03466 * LysR_substrate 0.00048 33.3 39/209  
:BLT:SWISS 1->138 YNFL_ECOLI 1e-16 38.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69236.1 GT:GENE BAC69236.1 GT:PRODUCT putative LysR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1867505..1868419 GB:FROM 1867505 GB:TO 1868419 GB:DIRECTION + GB:PRODUCT putative LysR-family transcriptional regulator GB:NOTE PF00126: Bacterial regulatory helix-turn-helix protein, lysR family GB:PROTEIN_ID BAC69236.1 LENGTH 304 SQ:AASEQ MELRQLRYFLAVAEELNFGRAAERLLIAGPSLSQQIKTLERDLGVRLFDRDRRSVSLTPAGTALLPYTRSLLERADDLQRRARRLGGSEPVRLGYVNWLPADLTARASAVAQLHIDAWVAPSHAQAARVADGSLDLAVCWVRNEDLERHGLRARLIGADRLYAVTTGSDPSGVGAQDTVVLLDDDTTSWSSWNVYAEQLAHDTGARTVRISDGGVTGPAFFDHVRRGRRPVVNSPKGQTTPLPPDLVQRPVIAPKIYWTWSLVWRSSEVRAAVLAVVDTLTDGVGDLGIHAPDAWLPDGDPYKR GT:EXON 1|1-304:0| BL:SWS:NREP 1 BL:SWS:REP 1->138|YNFL_ECOLI|1e-16|38.4|138/297| SEG 71->85|lleraddlqrrarrl| SEG 177->187|dtvvlldddtt| BL:PDB:NREP 1 BL:PDB:REP 1->69|1iz1B|2e-09|39.1|69/294| RP:PDB:NREP 2 RP:PDB:REP 1->69|1b9nA|5e-19|17.6|68/258| RP:PDB:REP 188->265|2d0qA|6e-06|17.6|74/191| RP:PFM:NREP 1 RP:PFM:REP 3->61|PF00126|2e-11|55.9|59/60|HTH_1| HM:PFM:NREP 3 HM:PFM:REP 3->61|PF00126|2.3e-25|57.6|59/60|HTH_1| HM:PFM:REP 103->166|PF03466|8.2e-07|24.6|61/209|LysR_substrate| HM:PFM:REP 244->282|PF03466|0.00048|33.3|39/209|LysR_substrate| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 2->69|1ixcA1|4e-18|49.2|63/84|a.4.5.37| RP:SCP:REP 98->280|2esnA2|7e-04|16.0|181/210|c.94.1.1| HM:SCP:REP 1->89|1ixcA1|2.6e-25|47.2|89/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 90->286|1ixcA2|1.2e-05|23.2|190/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2326 OP:NHOMOORG 523 OP:PATTERN -------------------------------------------------------------------- 332-D113444312723----5111C-----1555588HJ-A3811---21-3432-5--223-A3FBD52--------1445----------1-------61121--12--------------------------12211---213--2---1111---------53-41------------111-----316333333341333342--65563341113121133321A9---------------1---1122111112122222--212--1---111----------------------------------------1-1-532222222-2-1122----2----2-2--222-11111-------11-12111-----236A9--1261221111112-113-13422B46571-B3341247B553783--21421231-24344444462222-12-------------------------------67-13JEAJFIIMJG8AAAAFFHH99AA8DPBMCLFF-196735596G6B1H245121114311111-1-1133511----3-115113-2-1214-1-33134511--1----------------------225531222122-2-------2-----22-------124------74552758766865677-77788557877686677659B9572517465777776767657655455552-344455435555---1111111211-1438---------------775584512-C3CDDCCFDC6ADA94678-----------1112222212-2246465663332111---1-----------------------------------------------------41 -------------1------------------------------------------------------------------------------------------------------------------------------------------------3-----------------------------5-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 238 STR:RPRED 78.3 SQ:SECSTR EcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHcHHHHHHHHHHcccccccTTccccTTHHHHTcccEEHHHHcccccEEEEEEEccccccccGGGGGGcT#######################HHHcHHHHHHHHHcHHHH####HHHHTcccTTcccEEEEEccTTEEEEEHHHHccccHHHHcHHHHHHTTTcHHHHHH####################################### DISOP:02AL 84-86, 297-304| PSIPRED ccHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHccEEEEEcccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEEEEEEccccccccccEEEEEEEcccEEEEEcccccccccccccHHHHcccccccccccHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHcccEEEHHHHHHHHcccccEEEEEccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccccccccc //