[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69238.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  85/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:352 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   130->327 1zc6B PDBj 4e-17 41.7 %
:RPS:PDB   97->332 2ch6B PDBj 4e-11 17.4 %
:RPS:SCOP  153->340 2ch5A1  c.55.1.5 * 3e-27 22.0 %
:HMM:SCOP  31->150 1zc6A1 c.55.1.5 * 7e-05 26.9 %
:HMM:SCOP  151->353 2ch5A1 c.55.1.5 * 1.5e-39 41.1 %
:RPS:PFM   96->205 PF01869 * BcrAD_BadFG 5e-04 41.2 %
:HMM:PFM   128->294 PF01869 * BcrAD_BadFG 7.6e-21 23.2 138/268  
:BLT:SWISS 96->167 Y577_RHOSR 8e-04 36.1 %
:BLT:SWISS 139->332 NAGK_DICDI 2e-08 29.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69238.1 GT:GENE BAC69238.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1870024..1871082 GB:FROM 1870024 GB:TO 1871082 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01869: BadF/BadG/BcrA/BcrD ATPase family GB:PROTEIN_ID BAC69238.1 LENGTH 352 SQ:AASEQ MTPTGAAPGGRDGTPDGPGPRADPTAAAGRSDVVLAVDSGGSGLRAVLAARGGGGAALSAPLVSKEPVRTGPRGIDAGQLLEHLLPMARQLLADAEAGGPCAVAIGAAGFATLGDGLRAELPSALARELGVPRVALAADAVTAYTGALGVRPGAVVAAGTGLIAVGTDLRSWRRADGWGHLLGDCGSGAWIGRAGLEAALRAHDGRPGGSPRLLARAEERFGPVASLPGKLYPRTDRPAVLASFAPEVAACAPGDPVSAGVLRTAARHMAESAAAVCPASGHPQVALTGGLFKMGAPLLVPLGEELAVQLPHARRVTAEGDPLHGAVRIALDLAAGSLTLPCDEHMLYVVTE GT:EXON 1|1-352:0| BL:SWS:NREP 2 BL:SWS:REP 96->167|Y577_RHOSR|8e-04|36.1|72/514| BL:SWS:REP 139->332|NAGK_DICDI|2e-08|29.4|194/323| SEG 3->30|ptgaapggrdgtpdgpgpradptaaagr| SEG 39->64|sggsglravlaarggggaalsaplvs| BL:PDB:NREP 1 BL:PDB:REP 130->327|1zc6B|4e-17|41.7|180/288| RP:PDB:NREP 1 RP:PDB:REP 97->332|2ch6B|4e-11|17.4|235/310| RP:PFM:NREP 1 RP:PFM:REP 96->205|PF01869|5e-04|41.2|102/266|BcrAD_BadFG| HM:PFM:NREP 1 HM:PFM:REP 128->294|PF01869|7.6e-21|23.2|138/268|BcrAD_BadFG| RP:SCP:NREP 1 RP:SCP:REP 153->340|2ch5A1|3e-27|22.0|186/224|c.55.1.5| HM:SCP:REP 31->150|1zc6A1|7e-05|26.9|108/0|c.55.1.5|1/1|Actin-like ATPase domain| HM:SCP:REP 151->353|2ch5A1|1.5e-39|41.1|202/0|c.55.1.5|1/1|Actin-like ATPase domain| OP:NHOMO 108 OP:NHOMOORG 101 OP:PATTERN ------1-11111111-2---------------------------------------1---------- -1--1--------------------2-----------------1--------1-11-------1-111111-------------------------------------1------------------------------------------------1---1-----11-1-1-----1---------------111111-1-1-111-------11----11--------2-----------------------------1-1------------------------------------------------------------1-1----------------1111----1----------------1-------1---------------------11111111112---------12--1---111111--------1-----111--------------------------------------------------------1--1-1--------1-------11---------------------------1-------------------------------------------------------------------------11------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------113-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 76.7 SQ:SECSTR #######################################################################cccccHHHHHHHHHHHHHHHHHHHTccccccccccccEEEETTccccHHHTGGGTTccccccccEEEHHHHHHTTccTTccEEEEEccccEEEEEEcTTccEEEccccTTTccTTcHHHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHTcccHHGGTTTcccHHHHHTTHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHTccTTcEEEEEEcGGGGGHHHHHHHHHHHHHHHHHHHTcEEEcccTHHHHHHHHTTTTTcccccc########### DISOP:02AL 1-25| PSIPRED ccccccccccccccccccccccccccccccccEEEEEEEcccEEEEEEEcccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHccccccEEEEEcccEEEEEEEccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHcccccHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHccccccccccccEEEEEEc //