[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69239.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:307 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69239.1 GT:GENE BAC69239.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1871275..1872198 GB:FROM 1871275 GB:TO 1872198 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01903: CbiX GB:PROTEIN_ID BAC69239.1 LENGTH 307 SQ:AASEQ MSSPTGPASGLPVRMPRPRQPGRHRRPEPLAAPEGAPALVLAVPGTPSAATRSLAEEVVSIARSELPGLDARIGYLDGDTSEFPTLQSVLVRTFEERTARFEQARAAGMDVKEPDGPVAVVVPLLAGPDSALLRQVRQAVMDSRIAADLTDVLGPHPLLAEALHVRLSEAGLARADRARLFTVATAADGIILASVGGDEAVQAAGITGMLLAARLAVPVMAAALDEEGSIAATAEQLRSSGSQQLALAPYLIGPEIDAGLLDAAAQEAGCSAAEALGPYPAIGKLVLAKYTTALGIAPQQPQGAPVR GT:EXON 1|1-307:0| SEG 14->44|rmprprqpgrhrrpeplaapegapalvlavp| SEG 114->129|pdgpvavvvpllagpd| SEG 209->224|mllaarlavpvmaaal| SEG 263->275|aaaqeagcsaaea| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-32, 300-307| PSIPRED ccccccccccccEEccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHHHHccccHHHHHccccccccccEEEEEHHHccccHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHccccccccHHccccccccEEEEEEccccccccHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHccccEEEEEHHHHHcccHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHHHHHcccccccccccc //