[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69240.1
DDBJ      :             putative secreted protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  305/915 : Eukaryota  67/199 : Viruses  0/175   --->[See Alignment]
b.68.6b.69.2b.70.2
:346 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->326 3fgbB PDBj 7e-36 35.4 %
:RPS:PDB   158->339 1c5kA PDBj 1e-05 16.6 %
:RPS:SCOP  32->113 1v04A  b.68.6.2 * 8e-04 21.8 %
:RPS:SCOP  158->319 1jmxB  b.69.2.2 * 2e-11 20.5 %
:HMM:SCOP  32->326 1nirA2 b.70.2.1 * 2.5e-39 34.3 %
:RPS:PFM   32->325 PF10282 * Muc_lac_enz 1e-49 46.5 %
:HMM:PFM   11->343 PF10282 * Muc_lac_enz 1.4e-99 42.5 332/345  
:BLT:SWISS 12->343 YKGB_BACSU 3e-41 34.3 %
:REPEAT 3|38->116|139->220|239->316
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69240.1 GT:GENE BAC69240.1 GT:PRODUCT putative secreted protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1872321..1873361) GB:FROM 1872321 GB:TO 1873361 GB:DIRECTION - GB:PRODUCT putative secreted protein GB:PROTEIN_ID BAC69240.1 LENGTH 346 SQ:AASEQ MTDGGRRRRRAFIGSFTAAGGLGVLTAAVDEDTGALTVLGGADGVPDPSYLALSPDGGMLYAVSETADGAVAAYRVEDDKPELTAPPVPVGGSGPTHLSVHAGHVLIANYGSGSVTAVPLRADGTPADEGATVLQHAGAGPDPKRQQSPHAHQVLPDPSGRWIVSVDLGTDSVRVCILHGGALAVHREIALRPGSGPRHLAFHPDGDRAYVLNELTPMVTVCRWDPADGALKPVAETPVLPGAPEGDAYPSGIVVSPDGRFVWTATRGKDVISVLAVEKDGLRLVTTVPCGGAWPRALTLAGRFLYVANERSGNVTWFAVDPTTGLPRRGGSIEAPAASCVVFDRV GT:EXON 1|1-346:0| BL:SWS:NREP 1 BL:SWS:REP 12->343|YKGB_BACSU|3e-41|34.3|327/349| NREPEAT 1 REPEAT 3|38->116|139->220|239->316| SEG 17->29|taagglgvltaav| BL:PDB:NREP 1 BL:PDB:REP 30->326|3fgbB|7e-36|35.4|288/347| RP:PDB:NREP 1 RP:PDB:REP 158->339|1c5kA|1e-05|16.6|169/397| RP:PFM:NREP 1 RP:PFM:REP 32->325|PF10282|1e-49|46.5|282/311|Muc_lac_enz| HM:PFM:NREP 1 HM:PFM:REP 11->343|PF10282|1.4e-99|42.5|332/345|Muc_lac_enz| RP:SCP:NREP 2 RP:SCP:REP 32->113|1v04A|8e-04|21.8|78/332|b.68.6.2| RP:SCP:REP 158->319|1jmxB|2e-11|20.5|156/339|b.69.2.2| HM:SCP:REP 32->326|1nirA2|2.5e-39|34.3|271/0|b.70.2.1|1/1|C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase| OP:NHOMO 483 OP:NHOMOORG 373 OP:PATTERN ---------------------------1---------------------------------------- 2-2-2---------------------------------1-----111-111111---1--11111-22221---------1-------1121--------12-1-2-2-1-----------------------------------------------------------------------------------11111111111111111-1111112----2--111111-21111111111111111111111111112111111111111211111-------1--11111111111-------------111---1111---11-------1-1-----1111-----1--------------------1-2-----------111---------------------------1----1-------------1------------11111111-111--------------------------------------------233212211111113111111211------114-----1-1-2-----1---------------11-----------------------------1-----------------------------1----1-------------------------------------1112-211111111111-1111111111111--11-2222221111111111111111111211111111-2111111-1111-11------------------------------111111----1-11111112-11111222-------------------11111--1-1------------------------------------------------------------------2- ------2--------111111111213------1111111-11---21323322443221-1------------------------11-2421121234113-1-1-14------------------------------------------------------------------1--14---------2-1125456- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 336 STR:RPRED 97.1 SQ:SECSTR #######EEEEEEEEcccccccEEEEEEEcTTTccEEEEEEEEEccccccEEEcccccEEEEEEccccTTcEEEEEEEETTTTEEEEEEcccccEEEEEEcccEEEEEETTTTEEEEEEccTTccccHHHHcHHHHTTccccEEEccccccccccccTTccEEEEEEcTTcccEEEEEETTTccEEEcccccccccEEEEEEcTTccEEEEEEcTTcccEEEEEETTccccEEcccEcccTTccEcccEEEEEEEcTTccEEEEEEETEEEEEEEETTTccEEEccccHHcccEEEEEcTTccEEEEEEEETTEEEEEEEETTcccEEEccEEEEEEEcEEEE### DISOP:02AL 1-4| PSIPRED ccccccccEEEEEEEEEcccccEEEEEEEcccccEEEEEEEEccccccEEEEEEccccEEEEEEEccccEEEEEEEEccccEEEEEEEEccccccEEEEEcccEEEEEEEcccEEEEEEcccccEEEEEEEEEEEcccccccccccccccEEEEEEcccccEEEEEEccccEEEEEEEccccEEEEEEEEEccccccEEEEEEccccEEEEEEcccccEEEEEEEccccEEEEEEEEEcccccccccccccEEEEEccccEEEEEEccccEEEEEEEEccccEEEEEEEcccccccEEEccccEEEEEEccccEEEEEEEccccccEEEccEEEcccEEEEEEEcc //