[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69242.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:535 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   221->482 PF04632 * FUSC 5.1e-11 28.9 246/650  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69242.1 GT:GENE BAC69242.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1875451..1877058) GB:FROM 1875451 GB:TO 1877058 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:NOTE PF01027: Uncharacterised protein family UPF0005 SAV1531.1 GB:PROTEIN_ID BAC69242.1 LENGTH 535 SQ:AASEQ MDALMCRSMALRTPRRLLCAGRAPWRRNLGRENVWKRMFVAPDPGLLRLRSATRAVLGIGLAVTLCGLAGHSLVGAVAGGLAALLALFTVADATVRGQATTTALLPVVGFPVLALAAGLHEHPVARDAAFVAVVAAGVYARRWGPRGHSLGVFAFMAFFVAQFLRTVPDQLPELYGATLLALSASSAVRFGLWCYERRMPPVAASAPLTGRGLARPTNRQAVQAAVAAAFALVAGQMVSPERWYWAVGAAWWVFVNTTSRGETLIRGFRRVLGTVIGIALGLLVVVPLHGAPVPTAALVAVCVFGIFYSAPVSYTWMMLAVTVMAELLYGVLGVLDPHLIALRLVETGVGALGAVLAVLFVLPVSTHVITDAWIARALRCVHRCTAETAARLQGSATADPTAHVAELEVLLSRVGLSLAPLVHPLNPLRARGRRARRVLALLRTCADEVRGLAAIASDPEASHDPRLSAACERVEAAVEALTTPGSPGVGVPAGGRTAAGPAEEPVLAHLHGIERALHELTAPLRDAHDPGLARA GT:EXON 1|1-535:0| TM:NTM 8 TM:REGION 63->85| TM:REGION 99->121| TM:REGION 123->140| TM:REGION 168->190| TM:REGION 219->240| TM:REGION 277->299| TM:REGION 317->339| TM:REGION 347->369| SEG 67->87|glaghslvgavagglaallal| SEG 124->142|vardaafvavvaagvyarr| SEG 152->163|vfafmaffvaqf| SEG 179->187|llalsassa| SEG 220->236|qavqaavaaafalvagq| SEG 271->288|vlgtvigialgllvvvpl| SEG 348->359|gvgalgavlavl| SEG 428->443|lrargrrarrvlallr| SEG 469->480|aacerveaavea| SEG 484->495|pgspgvgvpagg| HM:PFM:NREP 1 HM:PFM:REP 221->482|PF04632|5.1e-11|28.9|246/650|FUSC| OP:NHOMO 19 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ---------------11-------1------------------------------------------231--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111111-----------------------------------------------------------------------------------1---------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-7, 529-535| PSIPRED ccHHHHHHHHHHcHHHHHHcccccHHHccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccc //