[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69243.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->50 PF03484 * B5 0.00055 26.9 26/70  
:BLT:SWISS 22->52 RL9_BURVG 8e-04 53.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69243.1 GT:GENE BAC69243.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1877224..1877448 GB:FROM 1877224 GB:TO 1877448 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69243.1 LENGTH 74 SQ:AASEQ MSGPLPVIVSPPSPTGGRRVRVDGEILGLAYNLGDVAEFLRRAGMDMEPVQVAVSPLIDWRGVGPEYWGPETRA GT:EXON 1|1-74:0| BL:SWS:NREP 1 BL:SWS:REP 22->52|RL9_BURVG|8e-04|53.3|30/150| HM:PFM:NREP 1 HM:PFM:REP 25->50|PF03484|0.00055|26.9|26/70|B5| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 71-74| PSIPRED cccccEEEEEccccccccEEEEcccEEcEEccHHHHHHHHHHccccccccccccccEEEEEccccccccccccc //