[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69245.1
DDBJ      :             putative AsnC-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  46/68 : Bacteria  451/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.58.4
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->148 2znzC PDBj 9e-21 31.2 %
:RPS:PDB   4->148 2e1cA PDBj 3e-22 31.7 %
:RPS:SCOP  4->62 1i1gA1  a.4.5.32 * 3e-12 35.6 %
:RPS:SCOP  63->148 1ri7A2  d.58.4.2 * 3e-19 30.2 %
:HMM:SCOP  1->63 2cg4A1 a.4.5.32 * 3.4e-14 39.7 %
:HMM:SCOP  63->148 1ri7A2 d.58.4.2 * 5.1e-21 43.0 %
:RPS:PFM   9->49 PF08220 * HTH_DeoR 5e-05 43.9 %
:RPS:PFM   71->137 PF01037 * AsnC_trans_reg 2e-07 43.3 %
:HMM:PFM   69->139 PF01037 * AsnC_trans_reg 3.3e-22 42.3 71/74  
:HMM:PFM   8->50 PF01047 * MarR 4.1e-07 48.8 43/59  
:BLT:SWISS 1->148 REG6_PYRAB 6e-20 30.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69245.1 GT:GENE BAC69245.1 GT:PRODUCT putative AsnC-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1878051..1878527 GB:FROM 1878051 GB:TO 1878527 GB:DIRECTION + GB:PRODUCT putative AsnC-family transcriptional regulator GB:NOTE PF01037: AsnC family GB:PROTEIN_ID BAC69245.1 LENGTH 158 SQ:AASEQ MAVDELDTRILRLLLEQPRTSVREYARILGVARGTLQARLDRLERDGVITGTGPALSPAALGHPVLAFVHIEVTQGHLDDVGDALAAVPEIVEAFSITGGGDLLTRVVARDNGHLEDVIQSLISMPGVVRTRTEVALRERVPHRLLPLVESIGRTAAK GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 1->148|REG6_PYRAB|6e-20|30.4|148/151| BL:PDB:NREP 1 BL:PDB:REP 5->148|2znzC|9e-21|31.2|144/144| RP:PDB:NREP 1 RP:PDB:REP 4->148|2e1cA|3e-22|31.7|145/147| RP:PFM:NREP 2 RP:PFM:REP 9->49|PF08220|5e-05|43.9|41/56|HTH_DeoR| RP:PFM:REP 71->137|PF01037|2e-07|43.3|67/74|AsnC_trans_reg| HM:PFM:NREP 2 HM:PFM:REP 69->139|PF01037|3.3e-22|42.3|71/74|AsnC_trans_reg| HM:PFM:REP 8->50|PF01047|4.1e-07|48.8|43/59|MarR| GO:PFM:NREP 7 GO:PFM GO:0003700|"GO:transcription factor activity"|PF08220|IPR001034| GO:PFM GO:0005622|"GO:intracellular"|PF08220|IPR001034| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08220|IPR001034| GO:PFM GO:0003700|"GO:transcription factor activity"|PF01037|IPR019887| GO:PFM GO:0005622|"GO:intracellular"|PF01037|IPR019887| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01037|IPR019887| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01037|IPR019887| RP:SCP:NREP 2 RP:SCP:REP 4->62|1i1gA1|3e-12|35.6|59/60|a.4.5.32| RP:SCP:REP 63->148|1ri7A2|3e-19|30.2|86/86|d.58.4.2| HM:SCP:REP 1->63|2cg4A1|3.4e-14|39.7|63/0|a.4.5.32|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 63->148|1ri7A2|5.1e-21|43.0|86/0|d.58.4.2|1/1|Dimeric alpha+beta barrel| OP:NHOMO 1327 OP:NHOMOORG 498 OP:PATTERN --111111222222123111111123321221111121--------1-------4342432---5--1 -2--7---1111--51123-23--21222223122224A911115311-22-858235--772-6359A7------------------33221311---21524332312---------------11111111111---------1---1---------------------------------2----------222222112122222-311-1212--111---------3-----------------------1--11-----11----------------------------------------------------------11-------1-111---11111-----11-1----------------2--2443-----213241112114133433443448-2242251449--755356B86998322111474334238--------31121-25-------------------------------4A4-76554ECEDDD854448887777768BB85667--11423545434151113----6211111-1---12-----11---13----2-1----------1------------------------------342---111413111112111113112111--1----------111-1121111111111-111111111111111111122212231111111111111111131111111--111111111111---3------------14111111-1111-11144443341211244445537477741445---------1112-33333354442222222111--------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 93.7 SQ:SECSTR ccccHHHHHHHHHHHHcTTccHHHHHHHHTccHHHHHHHHHHHHHTTccccccccccGGGGTccEEEEEEEEEcTTcHHHHHHHHHTcTTEEEEEEccccccEEEEEEEccHHHHHHHHHHHHHcTTEEEEEEEEccccccccccccc########## DISOP:02AL 150-158| PSIPRED ccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEcHHHHcccEEEEEEEEEccccHHHHHHHHHHcccEEEEEEEcccccEEEEEEEccHHHHHHHHHHHHHccccEEEEEEEEEEEEEccccccccccccccccc //