[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69246.1
DDBJ      :             putative hydrolase
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  610/915 : Eukaryota  48/199 : Viruses  1/175   --->[See Alignment]
c.108.1
:231 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->171 1z4oB PDBj 1e-16 30.4 %
:RPS:PDB   9->171 3d6jA PDBj 1e-26 20.1 %
:RPS:SCOP  9->191 2hszA1  c.108.1.6 * 9e-32 19.2 %
:HMM:SCOP  1->191 1te2A_ c.108.1.6 * 1.7e-49 37.2 %
:RPS:PFM   9->161 PF00702 * Hydrolase 3e-07 30.1 %
:HMM:PFM   8->182 PF00702 * Hydrolase 5.3e-27 29.0 169/192  
:BLT:SWISS 8->190 YNIC_ECOLI 1e-20 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69246.1 GT:GENE BAC69246.1 GT:PRODUCT putative hydrolase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1878548..1879243 GB:FROM 1878548 GB:TO 1879243 GB:DIRECTION + GB:PRODUCT putative hydrolase GB:NOTE PF00702: haloacid dehalogenase-like hydrolase GB:PROTEIN_ID BAC69246.1 LENGTH 231 SQ:AASEQ MSTLGTTSVVFDLDGTLVDSEPNYYEAGRHLLAEQGVTDFTWADHEQYVGISTQESLELWKERYGVEAPLDDLLADMNRRYLALARASTPVYPEMRKFVELLAGEGVPMAVASGSSPEAIEAILTGTGLASWLTTVVSADEVARGKPAPDVFLEAARRLGVSPADCVVLEDAAPGAAAAHAARMRCIAIPYVAAQADDPAFATAGLLVRGGQTEFTARAAYEWLARSTPSS GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 8->190|YNIC_ECOLI|1e-20|30.1|183/222| SEG 172->182|aapgaaaahaa| SEG 193->204|aaqaddpafata| BL:PDB:NREP 1 BL:PDB:REP 8->171|1z4oB|1e-16|30.4|161/215| RP:PDB:NREP 1 RP:PDB:REP 9->171|3d6jA|1e-26|20.1|159/206| RP:PFM:NREP 1 RP:PFM:REP 9->161|PF00702|3e-07|30.1|153/195|Hydrolase| HM:PFM:NREP 1 HM:PFM:REP 8->182|PF00702|5.3e-27|29.0|169/192|Hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00702|IPR005834| GO:PFM GO:0008152|"GO:metabolic process"|PF00702|IPR005834| RP:SCP:NREP 1 RP:SCP:REP 9->191|2hszA1|9e-32|19.2|182/224|c.108.1.6| HM:SCP:REP 1->191|1te2A_|1.7e-49|37.2|188/218|c.108.1.6|1/1|HAD-like| OP:NHOMO 1413 OP:NHOMOORG 668 OP:PATTERN --1---------------11111----1-1-------------------1------------------ 133-111211112-1------1---1------11112---131221121232112321--321222136421222111-1112------1---1-----125111413-2--------------13213321221422222111133-24--12222----111-12523--1-----1---132211111121-----1------11-112212--1-----22333332---1111111111111-111114-2-14-1---3311--22-2212112221212-11-----------1111111111111-11-111112-1-54222222222223331111512---2-------1-2---2221--21121111111114134511-3223222222223224-33232344241-122423224211--1-12124444221111111111331-131---------------------------------11-22123442533444444553333345462142--2233-1111212431-212111---12111----111-----21-1-----2321321-1112132-11--------11-----------1----435413112211122321-22221112213--1-221------54323334444444444-444445344444344444543413-132322222221222222433244441-333333323333---------11112-2322222-2-1111122-1-11111---4233132111222211443-1-1-11-11-122111112322312333333332222-----------------------------------------11----22--1-111112 -----------2111-------------------------------1-----------------------------------------------1----1-1-211-25-21---------------------------------------------1-13-1-11-2----1212662U21254768A-661122116 --1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 191 STR:RPRED 82.7 SQ:SECSTR cccccccEEEEcccTTTEEcHHHHHHHHHHHHHHTTcTccccHHHHTTTTccHHHHHHHHHccccHHHHccHHHHHHHHHHHHHHGGGcEEcTTHHHHHHHHHHHTcEEEEEccccHHHHHHHHHHTccTTcccEEEcGGGccccTTcTHHHHHHHHHTTccGGGEEEEEccHHHHHHHHHTTcEEEEEcc######################################## DISOP:02AL 1-2| PSIPRED cccccccEEEEcccccEEccHHHHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccccccEEEEcHHcccccccHHHHHHHHHHHcccHHHEEEEcccHHHHHHHHHcccEEEEEcccccccccHHHHcccEEEEccHHHHHHHHHHHHHHHHcccc //