[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69253.1
DDBJ      :             putative dehydrogenase
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  539/915 : Eukaryota  150/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:296 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->288 2uyyD PDBj 2e-34 33.2 %
:RPS:PDB   7->286 3ckyC PDBj 3e-50 26.7 %
:RPS:SCOP  7->162 1vpdA2  c.2.1.6 * 4e-27 26.3 %
:RPS:SCOP  168->286 1wp4A1  a.100.1.1 * 2e-16 16.0 %
:HMM:SCOP  5->163 1pgpA2 c.2.1.6 * 1.9e-40 37.3 %
:HMM:SCOP  166->294 1vpdA1 a.100.1.1 * 4.4e-22 26.6 %
:RPS:PFM   5->156 PF03446 * NAD_binding_2 9e-19 39.5 %
:RPS:PFM   166->214 PF07479 * NAD_Gly3P_dh_C 9e-04 38.8 %
:HMM:PFM   6->163 PF03446 * NAD_binding_2 7.2e-44 36.7 158/163  
:BLT:SWISS 7->288 GLYR1_CHICK 3e-34 33.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69253.1 GT:GENE BAC69253.1 GT:PRODUCT putative dehydrogenase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1885125..1886015) GB:FROM 1885125 GB:TO 1886015 GB:DIRECTION - GB:PRODUCT putative dehydrogenase GB:NOTE PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus GB:PROTEIN_ID BAC69253.1 LENGTH 296 SQ:AASEQ MTDTLTVSVLGTGIMGAAMARNLARAGHTVRAWNRTRAKAEPLAADGAHIADTPAEAVEGADVVLTMLHDGDAVLGVMRQAAPALRPGTAWIQSTTAGLDALTGLADFAREHRLAFFDAPVLGTRQPAEAGQLVVLAAGPTESRETVTPVFDAVGSRTLWTGEDGAAGSATRLKLVANSWVIAATNATGEVLALAKALGVDPQNFFDAIAGGPLDMGYLHAKADLVLNNGLTPASFAVSTAEKDARLIVQAGQEHGVRLDGAEASAERLHRAAAQGHADEDMAAVYYASFDETRTP GT:EXON 1|1-296:0| BL:SWS:NREP 1 BL:SWS:REP 7->288|GLYR1_CHICK|3e-34|33.2|277/553| BL:PDB:NREP 1 BL:PDB:REP 7->288|2uyyD|2e-34|33.2|277/291| RP:PDB:NREP 1 RP:PDB:REP 7->286|3ckyC|3e-50|26.7|277/296| RP:PFM:NREP 2 RP:PFM:REP 5->156|PF03446|9e-19|39.5|152/160|NAD_binding_2| RP:PFM:REP 166->214|PF07479|9e-04|38.8|49/145|NAD_Gly3P_dh_C| HM:PFM:NREP 1 HM:PFM:REP 6->163|PF03446|7.2e-44|36.7|158/163|NAD_binding_2| GO:PFM:NREP 6 GO:PFM GO:0004616|"GO:phosphogluconate dehydrogenase (decarboxylating) activity"|PF03446|IPR006115| GO:PFM GO:0006098|"GO:pentose-phosphate shunt"|PF03446|IPR006115| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03446|IPR006115| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF07479|IPR006109| GO:PFM GO:0016614|"GO:oxidoreductase activity, acting on CH-OH group of donors"|PF07479|IPR006109| GO:PFM GO:0055114|"GO:oxidation reduction"|PF07479|IPR006109| RP:SCP:NREP 2 RP:SCP:REP 7->162|1vpdA2|4e-27|26.3|156/161|c.2.1.6| RP:SCP:REP 168->286|1wp4A1|2e-16|16.0|119/132|a.100.1.1| HM:SCP:REP 5->163|1pgpA2|1.9e-40|37.3|158/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 166->294|1vpdA1|4.4e-22|26.6|128/0|a.100.1.1|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1758 OP:NHOMOORG 718 OP:PATTERN --1-1111222222211421122----1-1-------------1------1----1------11--11 124-23111111--66422-25112A2222225878548922271221-11-546334--2-211-73451----1--1---3111-------------------1-2----------------------------32222---12221-222--1122212221-11111-11----1--1-12112---2122222322223222223122222322222221111111311-------------------1-1-22-1---11--221111111-1---------------------------------------------1-11-------1-2-1---11------111--33-----1---------3122111-----427742233632211221222224-22622A27452-23333447477864212334-2--6451111111171122111-----------------------------32232-1742777777652221779A555536A5G9876-3442343233257562311--11311111111-1212-12--111111--2-2-21222-111112--11-------------111-11-----1111223-122222222213222212222111---1113------2211-113334354533-3333434323343333331223211--3233323333333333-2112222-----------------------1111133431113-2--1-11--133333241123-66463533433342212----------31111111132222--32222222------2---1111--------1-1------------------1----------------2-1 ----111-321-11241212445554412111121-1111211---22111324-1212212---------------------------121111-111111-111-2534543332121-111321415E2-335221-2-122111112123-32222234322-3291-1211352H232-244771741153432 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 294 STR:RPRED 99.3 SQ:SECSTR cccTTcEEEEcccTTHHHHHHHHHHTTcEEEEEcccHHHHHHHHTTTcEEcccHHHHHHHccEEEEccccHHHHHHHHTcTTHHccTTcEEEEcccccHHHHHHHHHHHHHTTcEEEEccEEcHHHHHHHTcEEEEEEccHHHHHHHHHHHHHHEEEEEEEEcTTHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHTcTTccHHHHHHccccccTccccccccHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHTTcTTccGGGGHHccccccT## DISOP:02AL 1-2, 294-296| PSIPRED cccccEEEEEEEcHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccEEEccHHHHHHcccEEEEEccccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHccccEEccccccccHHHHcccEEEEEcccHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccc //