[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69255.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:431 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   29->394 PF01757 * Acyl_transf_3 5e-33 20.8 322/340  
:BLT:SWISS 26->132 OPGC_ECOLI 3e-06 29.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69255.1 GT:GENE BAC69255.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1888040..1889335) GB:FROM 1888040 GB:TO 1889335 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:NOTE PF01757: Acyltransferase family GB:PROTEIN_ID BAC69255.1 LENGTH 431 SQ:AASEQ MVQAAVGGGAPVMATRIEQVGQALPERRPELDAIRMLVVFGLIFFHSALVFATDDDYYVKNSETTQVIMILAGFAVVWAMPVLFLISGLGSWYSLRRRGAAGFVKERLLRLGVPLVFATLVLNPLPQWLRLRSADPGYDESYLAFLPHFYDVHVELAEFPFLLQGEHFETGHLWFVVLLLAFSLMLAFLFRVLAADRLRPVTDRLAQATFRVRGAILLPALPLALLCAFAGLEEDYAGWHRWAYLVFFAAGCALAADDRVRTAMRRAAVPAGRLGGVLFALSGPGFAVADEPFTEMTALGMATRAFFGAAGWCLVVAILGHLDRRRAARAVGRTPDPLSSGRHRVYAYLGAAVLPVYVLHQPVVVAVAYFVVGWNAPIPVEYAVIVIISLAVTLSVYELLVRRTRVTRFLLGMRVNTPDRPPRPGTSPRSR GT:EXON 1|1-431:0| BL:SWS:NREP 1 BL:SWS:REP 26->132|OPGC_ECOLI|3e-06|29.5|105/385| TM:NTM 10 TM:REGION 32->53| TM:REGION 68->90| TM:REGION 107->129| TM:REGION 174->196| TM:REGION 213->233| TM:REGION 242->259| TM:REGION 267->285| TM:REGION 300->322| TM:REGION 348->370| TM:REGION 379->401| SEG 175->190|fvvlllafslmlaflf| SEG 214->232|gaillpalplallcafagl| SEG 363->372|vvvavayfvv| SEG 399->411|llvrrtrvtrfll| SEG 417->430|tpdrpprpgtsprs| HM:PFM:NREP 1 HM:PFM:REP 29->394|PF01757|5e-33|20.8|322/340|Acyl_transf_3| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------11-1----------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------1------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1--------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 418-431| PSIPRED ccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccccccccccccccc //