[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69256.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:199 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   71->195 PF11139 * DUF2910 1e-08 32.8 %
:HMM:PFM   45->194 PF11139 * DUF2910 1.6e-40 34.0 150/214  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69256.1 GT:GENE BAC69256.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1889510..1890109) GB:FROM 1889510 GB:TO 1890109 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69256.1 LENGTH 199 SQ:AASEQ MGVPAVAGCMPVRLGRLSPSGGRYMGKVLGDVGGSEGASGHGQPATWVGGGLKLGLGVLLALFGVRLWHRRPRDVSQARLPKWMAAIDSFTPVKIFGLALLLSAANIKNATFTIAASASISSSGIPLGQQIGALAVFVVIASLGILAPLAVFLIAGERARNTLDGWKNWAAQHNIPVMAVLCFVIGLKLLGDGIAILTG GT:EXON 1|1-199:0| TM:NTM 5 TM:REGION 1->23| TM:REGION 48->69| TM:REGION 93->115| TM:REGION 130->152| TM:REGION 174->196| SEG 48->67|vggglklglgvllalfgvrl| SEG 114->125|iaasasisssgi| RP:PFM:NREP 1 RP:PFM:REP 71->195|PF11139|1e-08|32.8|125/212|DUF2910| HM:PFM:NREP 1 HM:PFM:REP 45->194|PF11139|1.6e-40|34.0|150/214|DUF2910| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------11------1---------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 74-78| PSIPRED cccccHHHHHHHHHcccccccHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHccc //