[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69257.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  228/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.152.1
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->178 2gmyD PDBj 9e-22 33.8 %
:RPS:PDB   40->178 3c1lC PDBj 6e-17 25.2 %
:RPS:SCOP  47->178 2gmyA1  a.152.1.3 * 1e-21 28.0 %
:HMM:SCOP  32->179 2o4dA1 a.152.1.3 * 5.1e-35 35.4 %
:RPS:PFM   63->126 PF02627 * CMD 9e-08 46.9 %
:HMM:PFM   42->127 PF02627 * CMD 4.2e-23 39.3 84/85  
:BLT:SWISS 62->172 YDFG_BACSU 2e-18 35.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69257.1 GT:GENE BAC69257.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1890201..1890755) GB:FROM 1890201 GB:TO 1890755 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF02627: Carboxymuconolactone decarboxylase family GB:PROTEIN_ID BAC69257.1 LENGTH 184 SQ:AASEQ MAEETAAPKADAAAPRSFTLSDTTAGPVGTRGTRVFIDKQSPKAYHALVETSEAVRAVAADAGLDRVLVELINLRVSQINGCAYCLSLHTKAALRVGETTQRLGVLAAWRDTELFTSRERAALALAEVTTDPADATAQEHAYDAARQVLTDDEISAVIWVAVTINAFNRVSIMSKHPVRGIPHQ GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 62->172|YDFG_BACSU|2e-18|35.1|111/147| SEG 2->15|aeetaapkadaaap| BL:PDB:NREP 1 BL:PDB:REP 33->178|2gmyD|9e-22|33.8|142/145| RP:PDB:NREP 1 RP:PDB:REP 40->178|3c1lC|6e-17|25.2|131/175| RP:PFM:NREP 1 RP:PFM:REP 63->126|PF02627|9e-08|46.9|64/83|CMD| HM:PFM:NREP 1 HM:PFM:REP 42->127|PF02627|4.2e-23|39.3|84/85|CMD| RP:SCP:NREP 1 RP:SCP:REP 47->178|2gmyA1|1e-21|28.0|132/147|a.152.1.3| HM:SCP:REP 32->179|2o4dA1|5.1e-35|35.4|144/0|a.152.1.3|1/1|AhpD-like| OP:NHOMO 371 OP:NHOMOORG 230 OP:PATTERN -------------------------------------------------------------------- 12--5--1111--12------1---2------22223155-221--------1-1-11---11-2-3463------------1------------------3---312-2------------------------------------1-------------------1--------------------------------------------11-1--2---1---------12---------------1---1------------------------------------------------------------------------------------------------------------------------1--1--1-----2-5111-21-11-----------1-11--11--121-11113333632211-----11-11-11-------------1----------------------------------11--33234433342111133342222124213453--33----221-2-32-2-----2----------12---------------------1----111121---------------------------111---1-111--11111--111111-1-111-------------11---1--111-111---1---111-1-111-----1111211--1-111111111111111--1------1----------------------------1---------------------------111111221-1121----------------1-------11-22---------------------------------------------------------------------2- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 87.5 SQ:SECSTR #####################HHHHHHHccccHHHHHGTTcHHHHHHHHHHHHHHHcHHHcccccHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHcccHHHHHHHHGGGccccccHHHHHHHHHHHHHHcGGGccHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHTcccGGGT## DISOP:02AL 1-5, 8-10, 179-184| PSIPRED cccccccccccccccccccccHHHHHHHccccHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //