[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69268.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.273.1
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->139 1vmfC PDBj 3e-08 25.4 %
:RPS:PDB   14->139 2cu5C PDBj 1e-19 31.1 %
:RPS:SCOP  6->140 1vphA  d.273.1.1 * 5e-27 22.6 %
:HMM:SCOP  4->141 1vphA_ d.273.1.1 * 8.8e-31 33.1 %
:RPS:PFM   21->139 PF01894 * UPF0047 2e-09 28.8 %
:HMM:PFM   22->138 PF01894 * UPF0047 4.2e-29 29.6 115/118  
:BLT:SWISS 16->139 Y2586_MYCBO 3e-33 57.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69268.1 GT:GENE BAC69268.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1919349..1919771) GB:FROM 1919349 GB:TO 1919771 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF01894: Uncharacterised protein family UPF0047 GB:PROTEIN_ID BAC69268.1 LENGTH 140 SQ:AASEQ MSDAFTTRVLNVASGSQETVVDLTHDCEAFLRDTAAGRDGLLNVFVPHATAGVAIIETGAGSDDDLLAALHTLLPADDRWQHRHGSPGHGRDHVLPAVVAPHATLPVIDGRLQLGTWQSVCLVDTNQDNPNRQVRLSFLG GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 16->139|Y2586_MYCBO|3e-33|57.9|121/129| SEG 63->78|dddllaalhtllpadd| BL:PDB:NREP 1 BL:PDB:REP 8->139|1vmfC|3e-08|25.4|130/135| RP:PDB:NREP 1 RP:PDB:REP 14->139|2cu5C|1e-19|31.1|119/126| RP:PFM:NREP 1 RP:PFM:REP 21->139|PF01894|2e-09|28.8|118/120|UPF0047| HM:PFM:NREP 1 HM:PFM:REP 22->138|PF01894|4.2e-29|29.6|115/118|UPF0047| RP:SCP:NREP 1 RP:SCP:REP 6->140|1vphA|5e-27|22.6|133/138|d.273.1.1| HM:SCP:REP 4->141|1vphA_|8.8e-31|33.1|136/0|d.273.1.1|1/1|YjbQ-like| OP:NHOMO 49 OP:NHOMOORG 48 OP:PATTERN ---11-----------------------------------------1-1------------------- ---1-----------1111-11--1111111111111-111111---1------------111-1111111--------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11----1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 135 STR:RPRED 96.4 SQ:SECSTR #####TcEEEEEEEccccEEEEcHHHHHTTcTTHTccccEEEEEEcccccEEEEEEccccHHHHHHHHHHHHHHcccccTTcccTTTccHHHHHHHHHHccEEEEEEETTEEcccTTcEEEEEEccccccEEEEEEEEcE DISOP:02AL 1-5| PSIPRED ccccEEEEEEEEEEcccEEEEEccHHHHHHHHHcccccccEEEEEEccccEEEEEEEcccHHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHccEEEEEEEccEEccccEEEEEEEEEcccccccEEEEEEEc //