[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69276.1
DDBJ      :             putative MarR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   53->123 3f3xA PDBj 1e-10 40.8 %
:RPS:PDB   12->131 2a61A PDBj 2e-13 30.3 %
:RPS:SCOP  13->131 3broA1  a.4.5.28 * 4e-16 14.3 %
:HMM:SCOP  4->145 1jgsA_ a.4.5.28 * 1.2e-29 37.5 %
:HMM:PFM   36->94 PF01047 * MarR 4.6e-13 32.8 58/59  
:BLT:SWISS 7->129 YUSO_BACSU 5e-13 33.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69276.1 GT:GENE BAC69276.1 GT:PRODUCT putative MarR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1927957..1928412 GB:FROM 1927957 GB:TO 1928412 GB:DIRECTION + GB:PRODUCT putative MarR-family transcriptional regulator GB:NOTE PF01047: MarR family GB:PROTEIN_ID BAC69276.1 LENGTH 151 SQ:AASEQ MTTPDPDGLLAEQLLRLTRRVHRIQKRHLEQRGLGITPAQSRLLRTLAHYSSPPRMADLAQRLEVVPRAVTTLVDGLEASGKVRRVPDPTNRRVIRIEVTDEGRKALHELRGARRSAAEEILAPLTDDQREVLGGLLDTLVDGAPEGERHC GT:EXON 1|1-151:0| BL:SWS:NREP 1 BL:SWS:REP 7->129|YUSO_BACSU|5e-13|33.6|122/155| SEG 132->143|vlgglldtlvdg| BL:PDB:NREP 1 BL:PDB:REP 53->123|3f3xA|1e-10|40.8|71/139| RP:PDB:NREP 1 RP:PDB:REP 12->131|2a61A|2e-13|30.3|119/142| HM:PFM:NREP 1 HM:PFM:REP 36->94|PF01047|4.6e-13|32.8|58/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 13->131|3broA1|4e-16|14.3|119/135|a.4.5.28| HM:SCP:REP 4->145|1jgsA_|1.2e-29|37.5|136/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 39 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ---------------11--------2-------111-1-1-11111-------------------1-211-----------------------------------------------------------------------------------------------------------------1---------1--------------------1--1-------------1---------------------------------------------------------------------------------------------1--------------11----------------------------------1---------------------------------------------------2---221--------------------------------------------------------------1---------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 86.8 SQ:SECSTR cccccccTTHHHHHHHHHHHHHHHHHHHHHTHHHTccHHHHHHHHHHHHHcTcccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHH#################### DISOP:02AL 1-3, 145-150| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccc //