[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69277.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 13->52 DCTA_DIAST 7e-09 55.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69277.1 GT:GENE BAC69277.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1928740..1928997) GB:FROM 1928740 GB:TO 1928997 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69277.1 LENGTH 85 SQ:AASEQ MIYTDVTHAYPSTNLLGNCVAVFAVSRWEGALDTARAKKVLDGEIAFVPDDDDHAPRTDAETPEAEAAKPTVPARSVKEPAPEVG GT:EXON 1|1-85:0| BL:SWS:NREP 1 BL:SWS:REP 13->52|DCTA_DIAST|7e-09|55.0|40/450| SEG 55->74|aprtdaetpeaeaakptvpa| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 5-6, 56-70, 79-85| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccc //