[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69278.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  58/199 : Viruses  0/175   --->[See Alignment]
:541 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   208->334 2aw5C PDBj 3e-05 17.3 %
:RPS:PFM   78->349 PF12222 * PNGaseA 4e-58 48.5 %
:HMM:PFM   53->355 PF12222 * PNGaseA 3.7e-54 35.2 290/429  
:BLT:SWISS 55->348 PNAA_PRUDU 2e-43 36.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69278.1 GT:GENE BAC69278.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1929019..1930644) GB:FROM 1929019 GB:TO 1930644 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69278.1 LENGTH 541 SQ:AASEQ MSMLVGVILVASTLLGASPAPAAGKHTAEATPSAEPAPPAEFGTDWHDPLTAAPPIGKPATRSCQVTVAEAQFRDFTPYRGTYAPPRGCGDRWSRVVLRLDGKVRGRQFDRLGYLHIGGVEILRTSTPEPSPDGIEWSVEKDVTRYSDTFRQSRDVEMLIGNVVDDTYTGVIDVRATLTFYAADRTNGPAATPDRVLTLADGTTLTTPRNSERIVAEVYATGSGGGCEEFWYLTVPDSAPYSCKADKGPYREVQIKVDGQLAGIAAPFPTVWTGGWSNPFLWYVIPGPRAFDVKPIEYDLTPFAGLLNDGRPHRVDVSVVGVPEGQAGWSAPVNVLVWQDTKSTRVTGALTAHKAADLANSTTYTPGSEHRLDTEGGHRLTVAGYVNTSHGRVTTTVSRTLATTSAHRWTDGENMDGLQAVWNDDESVTADGRGPDRTTRIRRTYTMDGTTTLGPDDRLRSALTLGDRATAVESRGGRRTAWSRLDDTYTGDATYTANVPRDQRHAVATTSERYRLSGSAGCYDRNLVTVQGVLTRDRSDC GT:EXON 1|1-541:0| BL:SWS:NREP 1 BL:SWS:REP 55->348|PNAA_PRUDU|2e-43|36.5|288/100| SEG 27->41|taeatpsaepappae| SEG 392->406|rvtttvsrtlattsa| SEG 486->497|ddtytgdatyta| RP:PDB:NREP 1 RP:PDB:REP 208->334|2aw5C|3e-05|17.3|127/533| RP:PFM:NREP 1 RP:PFM:REP 78->349|PF12222|4e-58|48.5|264/406|PNGaseA| HM:PFM:NREP 1 HM:PFM:REP 53->355|PF12222|3.7e-54|35.2|290/429|PNGaseA| OP:NHOMO 80 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- 1---1--------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------1111111111-111111----------11111------11111111111-1--1--11-------1111----211111------4------1----------------------------------------------------------------------------4453123--1-11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 23.5 SQ:SECSTR ###############################################################################################################################################################################################################HHTHHHHHHHHcTTHHHHHHHHHEEEEGGGTTcHHHHHTTcccccccEEEcccccTccccGGGGGHHHHHHHHHHHHHHcccGGGEEEEEEEccccHHHHHcTTccccccccccTHHHHHHHHHHHH############################################################################################################################################################################################################### DISOP:02AL 14-27, 344-350, 538-541| PSIPRED cHHHHHHHHHHHHHHcccccccHHHHHHHccccccccccccccccccccEEEcccccccccccEEEEEEEEEEcccccEEEEEcccccccccccEEEEEEEEEEEEEEEEEEEEEEEccEEEEEccccccccccEEEEEEEcHHHHHHHHccccEEEEEEccccccEEEEEEEEEEEEEEEEccccccccccccEEEEEEcccEEEcccccEEEEEEEEEEEccccccccEEcccccccccccccccccEEEEEEEEccEEEEEEccccEEEEcccccHHHccccccccccccccEEEEccccHHHHcccEEEEEEEEEEEcccccccEEEEEEEEEEEccccccccccccEEcccEEEccccccccccEEEEEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEEEEEccccEEEEEEEEEEcccccccccccEEEcEEEEEEEEEcccccccccEEEEEEEEcccEEEEEEcccEEEEEEEccccccccEEEEEEEEcccccEEEEEEEEEEcccccEEEEEEEEEEccEEEEEEccc //