[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69288.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.7
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   20->122 1a0kA PDBj 8e-22 18.4 %
:RPS:SCOP  7->122 1skoB  d.110.7.1 * 2e-23 21.4 %
:HMM:SCOP  6->128 1j3wA_ d.110.7.1 * 6.3e-31 45.9 %
:RPS:PFM   10->97 PF03259 * Robl_LC7 3e-12 51.2 %
:HMM:PFM   8->97 PF03259 * Robl_LC7 1.1e-28 43.8 89/91  
:BLT:SWISS 17->118 Y310_METJA 2e-04 28.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69288.1 GT:GENE BAC69288.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1942608..1943024) GB:FROM 1942608 GB:TO 1943024 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF03259: Roadblock/LC7 domain GB:PROTEIN_ID BAC69288.1 LENGTH 138 SQ:AASEQ MAQNTGLGWLLDDLTERVEHVRHALVLSNDGLVTGASTGLRREDAEHLAAISSGLHSLAKGSGRHFGAGRVRQTMIEFDDAVLFVTAAGEGSCLSVLSAAEADIGQVAYEMTLLVNRVGEHLGVDARQPEKKTPTVDL GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 17->118|Y310_METJA|2e-04|28.0|100/114| RP:PDB:NREP 1 RP:PDB:REP 20->122|1a0kA|8e-22|18.4|103/130| RP:PFM:NREP 1 RP:PFM:REP 10->97|PF03259|3e-12|51.2|86/90|Robl_LC7| HM:PFM:NREP 1 HM:PFM:REP 8->97|PF03259|1.1e-28|43.8|89/91|Robl_LC7| RP:SCP:NREP 1 RP:SCP:REP 7->122|1skoB|2e-23|21.4|112/116|d.110.7.1| HM:SCP:REP 6->128|1j3wA_|6.3e-31|45.9|122/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 121 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ----9----------1111-11--1111111111116112-5462---1-----------64--575CBA6---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 81.2 SQ:SECSTR ##########HHTTTGGGTcccEEEEEETTccEEEEcTTcccccHHHHHHHHHHHHcTTccTTTcEEETTEEEEEEEEETTTEEEEEETTEEEEcEEEEEEEETTccHHHHHHHHHHHHHHH################ DISOP:02AL 1-3, 128-138| PSIPRED cccccHHHHHHHHHHHcccccEEEEEEcccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHccccccccccccccccc //