[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69289.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->124 1rfeA PDBj 2e-08 31.4 %
:RPS:PDB   3->137 3dmbA PDBj 5e-19 21.1 %
:RPS:SCOP  6->140 1rfeA  b.45.1.1 * 3e-20 24.6 %
:HMM:SCOP  1->139 1rfeA_ b.45.1.1 * 5.8e-29 31.9 %
:RPS:PFM   11->71 PF01243 * Pyridox_oxidase 8e-06 48.3 %
:HMM:PFM   10->94 PF01243 * Pyridox_oxidase 9.3e-22 32.1 84/89  
:BLT:SWISS 24->128 PDXH_HALHL 2e-05 33.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69289.1 GT:GENE BAC69289.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1943111..1943548 GB:FROM 1943111 GB:TO 1943548 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01243: Pyridoxamine 5'-phosphate oxidase GB:PROTEIN_ID BAC69289.1 LENGTH 145 SQ:AASEQ MGGMAQKMTEEEWRAFVSHGTRTGKLSTVRADGRPHVAPIWFLLDGDDLVFNTARDSVKGRNLARDGRAALCVDEDRPPFAFVVFQGQAELSEDLDEVRLWATRLGARYMGEERAEEFGSRNGVPGELLVRLRIDKVLAYSAVAD GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 24->128|PDXH_HALHL|2e-05|33.7|104/201| BL:PDB:NREP 1 BL:PDB:REP 5->124|1rfeA|2e-08|31.4|118/153| RP:PDB:NREP 1 RP:PDB:REP 3->137|3dmbA|5e-19|21.1|123/142| RP:PFM:NREP 1 RP:PFM:REP 11->71|PF01243|8e-06|48.3|60/88|Pyridox_oxidase| HM:PFM:NREP 1 HM:PFM:REP 10->94|PF01243|9.3e-22|32.1|84/89|Pyridox_oxidase| GO:PFM:NREP 1 GO:PFM GO:0010181|"GO:FMN binding"|PF01243|IPR011576| RP:SCP:NREP 1 RP:SCP:REP 6->140|1rfeA|3e-20|24.6|134/160|b.45.1.1| HM:SCP:REP 1->139|1rfeA_|5.8e-29|31.9|138/0|b.45.1.1|1/1|FMN-binding split barrel| OP:NHOMO 25 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ----1---------211---------------12221--1-2-2--------------------1--112------------1--------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 100.0 SQ:SECSTR HHcTcHHHHHHHHHHHHHHHccEEEEETTccccccEEEEEccccccccEEEEEcTTcTTHHHHTTcEEEEEEEEcTcTccEEEEEEEEEEEcccHHHHHHccHHHHHHcTTGGGcTTcEcccEcTTEEEEEEEEEEEEEcTTTcc DISOP:02AL 1-6| PSIPRED cccccccccHHHHHHHHHccccEEEEEEEcccccEEEEEEEEEEEccEEEEEEccccHHHHHHHccccEEEEEEccccccEEEEEEEEEEEEcccccHHHHHHHHHHHHcccccccccccccccccEEEEEEEEEEEEEEHHHcc //