[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69294.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  133/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:243 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   41->102 PF03707 * MHYT 1.1e-18 32.8 61/62  
:HMM:PFM   105->154 PF03707 * MHYT 4.1e-17 58.0 50/62  
:HMM:PFM   167->194 PF03707 * MHYT 1.1e-07 32.1 28/62  
:HMM:PFM   27->42 PF10399 * UCR_Fe-S_N 0.00015 37.5 16/41  
:BLT:SWISS 3->182 Y1727_PSEAE 3e-14 30.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69294.1 GT:GENE BAC69294.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1947688..1948419) GB:FROM 1947688 GB:TO 1948419 GB:DIRECTION - GB:PRODUCT putative integral membrane protein GB:NOTE PF03707: Bacterial signalling protein N terminal repeat GB:PROTEIN_ID BAC69294.1 LENGTH 243 SQ:AASEQ MLSYVMACIGAALGLRCTVRALGATGRSRRNWLITAASAIGTGIWTMHFVAMLGFSVSGTEIRYNVPLTILSLLVAMVVVGTGVFAVGYGRDRARALFLGGLTTGLGVASMHYLGMAALRLHGVVHYDPVLVGLSVLIAVVAATAALWAALNIQSPIAVAVASLVMGVAVSSMHYTGMIAVRVRVSPAGEVLPGATAMQFIFPLAVGLGSYLFLTSAFVALSPTAGEREASASAQQPVESVAR GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 3->182|Y1727_PSEAE|3e-14|30.2|179/685| TM:NTM 6 TM:REGION 1->23| TM:REGION 35->57| TM:REGION 66->88| TM:REGION 124->146| TM:REGION 151->172| TM:REGION 198->220| SEG 97->107|lflgglttglg| SEG 136->151|vliavvaataalwaal| HM:PFM:NREP 4 HM:PFM:REP 41->102|PF03707|1.1e-18|32.8|61/62|MHYT| HM:PFM:REP 105->154|PF03707|4.1e-17|58.0|50/62|MHYT| HM:PFM:REP 167->194|PF03707|1.1e-07|32.1|28/62|MHYT| HM:PFM:REP 27->42|PF10399|0.00015|37.5|16/41|UCR_Fe-S_N| OP:NHOMO 175 OP:NHOMOORG 133 OP:PATTERN -------------------------------------------------------------------- ------------------------------------31-----4--------------------1--221----------------------------------------------------------------------------------------------1----------------------------------------------111---------12------21-----------------------------------------------------------------------------------------------------------------------------------------------111------1-212--1--1--------------31111112-12-111-1112211---11--------------------11----------------------------------------112--122-2112221--21222211311---1--11---1--1---1-11---------------1------------------------------------------------------------------111-1-2-1----11-111--------------------------1---------------------------------------1-11111111-1111---------------------------------------1---------------------------111-11222222212121---------------------------1111112--------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 223-243| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHccc //