[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69296.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  109/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:252 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   26->124 2d0dA PDBj 1e-09 31.3 %
:RPS:PDB   26->248 3e3aB PDBj 4e-22 22.2 %
:RPS:SCOP  14->248 1mt3A  c.69.1.7 * 7e-21 19.7 %
:HMM:SCOP  8->250 1r3dA_ c.69.1.35 * 1.9e-33 27.8 %
:RPS:PFM   52->121 PF00561 * Abhydrolase_1 2e-09 44.3 %
:HMM:PFM   53->130 PF00561 * Abhydrolase_1 7e-15 36.0 75/231  
:HMM:PFM   15->79 PF12146 * Hydrolase_4 1.9e-05 29.7 64/79  
:BLT:SWISS 28->182 DMPD_PSEUF 2e-12 36.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69296.1 GT:GENE BAC69296.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1949240..1949998) GB:FROM 1949240 GB:TO 1949998 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00561: alpha/beta hydrolase fold GB:PROTEIN_ID BAC69296.1 LENGTH 252 SQ:AASEQ MKQAEFDGRGSMIRWTETPGFEPARVYVHGLGSASTVYHAHIAARPEMAGRRTLFVDLPGHGISDRPADYGYTLEDHADALSAALDEAGVSGAEIVAHSMGGAVAIVLAHRRPGLVSRLVLSEANLDPYPPVKAGSSGIASYEEADYVDNGGHARVLDKIGPTWAATMRLADPRALHRTAVNLARGTTPTMRRLLEGMTADRVYLQGELSGEVEGRRDLEAAGVRVVTVPGAGHNVMFDNPDAFAAEVVGVP GT:EXON 1|1-252:0| BL:SWS:NREP 1 BL:SWS:REP 28->182|DMPD_PSEUF|2e-12|36.8|136/283| BL:PDB:NREP 1 BL:PDB:REP 26->124|2d0dA|1e-09|31.3|99/271| RP:PDB:NREP 1 RP:PDB:REP 26->248|3e3aB|4e-22|22.2|221/275| RP:PFM:NREP 1 RP:PFM:REP 52->121|PF00561|2e-09|44.3|70/211|Abhydrolase_1| HM:PFM:NREP 2 HM:PFM:REP 53->130|PF00561|7e-15|36.0|75/231|Abhydrolase_1| HM:PFM:REP 15->79|PF12146|1.9e-05|29.7|64/79|Hydrolase_4| RP:SCP:NREP 1 RP:SCP:REP 14->248|1mt3A|7e-21|19.7|234/293|c.69.1.7| HM:SCP:REP 8->250|1r3dA_|1.9e-33|27.8|237/0|c.69.1.35|1/1|alpha/beta-Hydrolases| OP:NHOMO 171 OP:NHOMOORG 123 OP:PATTERN ------------------------1-----------------------------------------1- --2-2---------32222-22--31222222311112871112------1----1------1-21-211-------------------------------------------------------------1---131121------------------------------------------121-----1--------1-1-1---1-1------1-------------------------------------------------------------------------------------------------------------------------------------1---------------------2-1----------1-1---------------------11-1-----1--1111111211-----112----11--------------------------------------------------11----------1--1--------------1-11------------------1-------1------------------------1-----1--1-----11-11----1---------------------------------1--------1---------------1-------------1-------------------------------111-2----------------------------------------------------------------------------------------1------111-1-------------------------------------------1-------------------------------------------------------- -----------------------1-1--------------------1-----------------------------------------------------1------------------1---------------------1-1-------1--2-------------------------------22--1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 98.8 SQ:SECSTR ccEEEcccEEEccEEEEcEccccEEEEEccTTccGGGGTTTHHHHHHHTTEEEEEEccTTcGGGTTcccccccHHHHHHHHHHHHHHTTcccEEEEEETHHHHHHHHHHHHcGGGEEEEEEccccccHHHHHHTTccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHTTcccccccGGGGGGccccEEEEEETcccHHHHHHHHHHTTEEEEEETTccTTHHHHcHHHHHHHHH### PSIPRED cEEEEEEEccEEEEEEEccccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHcHHHHcEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHcccccEEEEEccccccccHHHHHHcccccEEEEccccccHHHccHHHHHHHHcccc //