[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69298.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  53/199 : Viruses  0/175   --->[See Alignment]
:301 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->250 PF09995 * DUF2236 1.9e-18 24.5 204/250  
:BLT:SWISS 46->121 SP0A_CLOB8 2e-04 30.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69298.1 GT:GENE BAC69298.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1950648..1951553) GB:FROM 1950648 GB:TO 1951553 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69298.1 LENGTH 301 SQ:AASEQ MKRFERLEQIRRMDPEKDALKIYRLTAAYEFPWDFTRALELALYRTYAVPSIGRLLAETAELTDRTQKRYDDTALLLDAVVEHGFDGAEGRSAIRRINQMHRSYDISNDDMRYVLSTFVVMPRRWVDAYAWRRLSRHEVVATTVYYRTLGRHMGIKDIPGTYEEFEDCLDTYEEAHFAWDADARRVADATLGLMTSWYPGPLAPLLRTSTFALLDEPLLRAFRYEPPGAATRALVRRAVRARGRMVRLLPPRRAPHFARRNWEVKGYPNGYRVGELGTTPVPGVRGCPVRHSGTSATAPVE GT:EXON 1|1-301:0| BL:SWS:NREP 1 BL:SWS:REP 46->121|SP0A_CLOB8|2e-04|30.7|75/100| SEG 178->189|awdadarrvada| SEG 229->249|aatralvrravrargrmvrll| HM:PFM:NREP 1 HM:PFM:REP 42->250|PF09995|1.9e-18|24.5|204/250|DUF2236| OP:NHOMO 107 OP:NHOMOORG 77 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------122-1--1--------11------11-1-11111----------------------------------------------------------------------------1------------1--------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------11---------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------2221-2-22214133111111232121111111111111-1--11--111-------------------------------233------1214--1----------------------------------------------------------------------------1---1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHccccccccccccccccccccccccccccccccccccEEcccc //