[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69300.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:293 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69300.1 GT:GENE BAC69300.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1952105..1952986 GB:FROM 1952105 GB:TO 1952986 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69300.1 LENGTH 293 SQ:AASEQ MAGTDEETVAAQDDALYVLTAVLLTPAKFPSVLGDDYPEACAALGLAPLADGYGLVLGQDGDGARWTVVIDDVSLVAVAIASWDCGMEYDLSPEEHTVVAALPGWPLAVAVAAPGVPAPHDPSPEVTDLEPLRPPDCETWGSAQRRLGADEIALQWATWRGQIGDDYFTNRNGEASAEEPVKADDGDGNNENDAGDDNVDSRNTPRRGIRRVLAEARSYVDTPPPLGRVRSSFAPGDARTLRADGPGWSIVARTDDIAFVLLDEEPGEVLPVGRGPELPGLLEALDKMAVRPA GT:EXON 1|1-293:0| SEG 98->119|vvaalpgwplavavaapgvpap| SEG 184->200|ddgdgnnendagddnvd| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1-----------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 170-204, 292-293| PSIPRED ccccccHHHHHcccHHHHHHHHHHccHHHHHHHccccHHHHHHHcccccccccEEEEEEcccccEEEEEEEccEEEEEEEEcccccccccccccccEEEEEcccccEEEEEcccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHccccHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHccccccccEEEEEccccEEEEEEcccEEEEEEEcccccEEEccccccccHHHHHHHHHccccc //