[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69301.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->70 PF01040 * UbiA 0.0003 27.3 44/258  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69301.1 GT:GENE BAC69301.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1953112..1953348) GB:FROM 1953112 GB:TO 1953348 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69301.1 LENGTH 78 SQ:AASEQ MHPFSGQRAAVAAKEATYMSKNAKIATGGVVVGLILWIWLPWWAALLIILGVPAAAYLALDPAQRRRLRRVTRKELGR GT:EXON 1|1-78:0| TM:NTM 1 TM:REGION 32->54| SEG 28->51|ggvvvglilwiwlpwwaalliilg| SEG 65->77|rrrlrrvtrkelg| HM:PFM:NREP 1 HM:PFM:REP 19->70|PF01040|0.0003|27.3|44/258|UbiA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 72-78| PSIPRED cccccccHHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHcc //