[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69307.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:164 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69307.1 GT:GENE BAC69307.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1962456..1962950 GB:FROM 1962456 GB:TO 1962950 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF05122: Mobile element transfer protein GB:PROTEIN_ID BAC69307.1 LENGTH 164 SQ:AASEQ MSPCGRLSVAPGTISGMGVRYDYFAAADDAGALARLHGDLGAVDDEFGLTGLKGADPDLILGPVEAGLTGRSVAEVEDDPRFTRLISDPQAEDRCLVTLTGTLRDALAGARPERLGQTAMTVVSGPEDSAGWDADLLADFLQRLAELSRHARVTHQQLYCLISL GT:EXON 1|1-164:0| SEG 25->42|aaaddagalarlhgdlga| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccEEcccccccccEEEEEEcccccccHHHccHHHHcccccHHcccccccccHHHHHHHHHHHcccccHHHcccccccEEEEEcccccccEEEEEcHHHHHHHccccHHHcccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEc //