[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69309.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->284 3bijA PDBj 2e-47 43.7 %
:RPS:PDB   3->284 3bijB PDBj 2e-32 47.4 %
:RPS:PFM   4->236 PF00656 * Peptidase_C14 3e-15 38.8 %
:HMM:PFM   17->266 PF00656 * Peptidase_C14 5.6e-33 28.7 209/243  
:BLT:SWISS 6->231 MCA1_USTMA 8e-17 31.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69309.1 GT:GENE BAC69309.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1964411..1965265 GB:FROM 1964411 GB:TO 1965265 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF00656: Caspase domain GB:PROTEIN_ID BAC69309.1 LENGTH 284 SQ:AASEQ MAHGISLHIGLNGVDRTKYGGWDGKLIACENDARDMEQLAKEAGIKERTTLLTPEATVDNITAELRKAAKVLTAGDLLLFSYSGHGGQVPDLNGPEDESDRLDETMCFFDREYIDDELYKEFEGFAEGVRILCFLDCCHSGSGIRVREILSPEAMEEQFQTTDPNQVETTARIMPLDMQAEMYDRNKEFFDDIQRKLNAKDNRDLGATALLISACQDNQLAADGLRNGLFTATVLQVWNGGKFTGGYKAFHREILKQMPAIQSPNLFITGRANNRFITERPFTL GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 6->231|MCA1_USTMA|8e-17|31.9|213/402| BL:PDB:NREP 1 BL:PDB:REP 4->284|3bijA|2e-47|43.7|254/258| RP:PDB:NREP 1 RP:PDB:REP 3->284|3bijB|2e-32|47.4|253/255| RP:PFM:NREP 1 RP:PFM:REP 4->236|PF00656|3e-15|38.8|188/224|Peptidase_C14| HM:PFM:NREP 1 HM:PFM:REP 17->266|PF00656|5.6e-33|28.7|209/243|Peptidase_C14| GO:PFM:NREP 2 GO:PFM GO:0004197|"GO:cysteine-type endopeptidase activity"|PF00656|IPR011600| GO:PFM GO:0006508|"GO:proteolysis"|PF00656|IPR011600| OP:NHOMO 71 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------------------------1------------1-------------------------------------1---------------------111---1----------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11--------------1------------1-11---------------------------------------------------1----------------------------------------11----2-1----2------------------1--1-----------------1-----------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------2---2--11---------------------------------11---------------1--------1------------1-1-1-221------1-31--2--------------------------------------------------------------------1-----112115-11-2----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 99.6 SQ:SECSTR #ccEEEEEEEcccccTTTTTTcccccccHHHHHHHHHHHHHHTTEEEEEEEEEGGGccHHHHHHHHHHHHHccTTcEEEEEEEccEEEEEcTTcccccTTcEEEEEEccccEEEHHHHHHHHTTcccccEEEEEEEccccccHHHHHHccEEcccHHHHHHHHTTccEEcccHHHHHHHHHHHHHTHHHHHHHHHHcccccGGGcccEEEEEEcccTTcccEEcccccHHHHHHHHHHGGGTccccHHHHHHHHHHHcTTEcccEEEEEEcccHHHHHccTTcc DISOP:02AL 190-203| PSIPRED ccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEccccEEEccccccccccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccEEEcccccccccccccccc //