[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69317.1
DDBJ      :             putative endonuclease III-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
a.96.1
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->158 2abkA PDBj 5e-04 34.3 %
:RPS:PDB   2->178 2abkA PDBj 7e-08 20.5 %
:RPS:SCOP  4->190 1keaA  a.96.1.2 * 8e-10 15.9 %
:HMM:SCOP  38->198 1ornA_ a.96.1.1 * 3.9e-10 30.8 %
:BLT:SWISS 78->181 END3_SYNY3 3e-05 34.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69317.1 GT:GENE BAC69317.1 GT:PRODUCT putative endonuclease III-like protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1972823..1973470 GB:FROM 1972823 GB:TO 1973470 GB:DIRECTION + GB:PRODUCT putative endonuclease III-like protein GB:NOTE PF00730: HhH-GPD superfamily base excision DNA repair protein GB:PROTEIN_ID BAC69317.1 LENGTH 215 SQ:AASEQ MQQDRRIIGELIAAHGTTYADEAGIRLKDAPQPLYRLLVMACLLSARIRSSVALAATRALYDAGLRDPRRMAEADWQERVDALGRGGYRRYDERTATQLGEGAELLIERWGGDLRRMRDEADGKVPELRRLLREIPGMGPAGADIFLREVQHVWPGVAPHLDNKALSGAERLGLPKDPRKLMERAGDTEPAVLAAALVRVALDKKSAREVLARVG GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 78->181|END3_SYNY3|3e-05|34.3|102/219| SEG 191->202|avlaaalvrval| BL:PDB:NREP 1 BL:PDB:REP 38->158|2abkA|5e-04|34.3|105/211| RP:PDB:NREP 1 RP:PDB:REP 2->178|2abkA|7e-08|20.5|151/211| RP:SCP:NREP 1 RP:SCP:REP 4->190|1keaA|8e-10|15.9|170/217|a.96.1.2| HM:SCP:REP 38->198|1ornA_|3.9e-10|30.8|143/214|a.96.1.1|1/1|DNA-glycosylase| OP:NHOMO 55 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- ----1----------1111-11----11111--111---1-111--1--------1----22----1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--1--1------------------------------------------------------------------------------------------------- -----------------1-11-12112---------1111111--------------------------------------------------------------------------------------------------------------------------------------------1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 85.6 SQ:SECSTR #HHHHHHHHHHHHHccGGGcccTccccccccccHHHHHHHHHHHTTTccHHHHHHHHHHHTTTccccHHHHHHHHHHHHHHHHTTcTTHHHHHHHHHHHccHHHHHHHTTTccHHHHHHHTTTcccccHHHHHHcTTccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccH############################## DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcc //