[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69318.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:412 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   162->366 PF01594 * UPF0118 2e-11 24.9 %
:HMM:PFM   76->396 PF01594 * UPF0118 2.7e-48 28.7 321/327  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69318.1 GT:GENE BAC69318.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1973812..1975050 GB:FROM 1973812 GB:TO 1975050 GB:DIRECTION + GB:PRODUCT putative integral membrane protein GB:NOTE PF01594: Domain of unknown function DUF20 GB:PROTEIN_ID BAC69318.1 LENGTH 412 SQ:AASEQ MSDGSRRPGSGSGRGRGRGGRRMRYIVLGSRPAHGVGAVARARTAEKATRRAGDRDGVTVNHGLRVAAAYAWRLLVVGVAVYVGFMTLGRLQLVAVALFLALVVTAVLRPPAGLLARRLPRAAAVAVSVVGSLVVALGLLALVGGLVAGEWDQLGREFGGGLGRIERWLEGPPFHVDPAVMSDLQGKVSSFVSEHRSQLISSALSGAGRVVEVLTAAVLALFCSIFFLHSGDNYWHWFLARLPEGAREPWGRAGRAAWRTFAGYTRGIIIVAASNAVLVGIALFALQVPLALPLTLLEFFAAFIPLVGSPIALAVATVVALASRGPVVAIAVLALIVVVGQIEGHLLHPLVMSWAVRLHPVVVALSVIAGSILAGVIGAVVAVPMVSVAWSVLSVLRPPHEPGAGHPGRSPG GT:EXON 1|1-412:0| TM:NTM 8 TM:REGION 81->103| TM:REGION 126->148| TM:REGION 208->229| TM:REGION 264->286| TM:REGION 294->316| TM:REGION 322->344| TM:REGION 347->369| TM:REGION 376->398| SEG 4->24|gsrrpgsgsgrgrgrggrrmr| SEG 38->52|avarartaekatrra| SEG 93->149|lvavalflalvvtavlrppagllarrlpraaavavsvvgslvvalgllalvgglvag| SEG 210->221|vvevltaavlal| SEG 285->303|alqvplalpltlleffaaf| SEG 312->322|alavatvvala| SEG 327->339|vvaiavlalivvv| SEG 367->392|viagsilagvigavvavpmvsvawsv| RP:PFM:NREP 1 RP:PFM:REP 162->366|PF01594|2e-11|24.9|205/328|UPF0118| HM:PFM:NREP 1 HM:PFM:REP 76->396|PF01594|2.7e-48|28.7|321/327|UPF0118| OP:NHOMO 31 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -----1--111--2-11----2----------1111----1111-2---1112-------11----121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-22, 43-56, 400-412| PSIPRED cccccccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //