[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69323.1
DDBJ      :             putative two-component system response regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  812/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->231 1kgsA PDBj 4e-17 31.8 %
:RPS:PDB   18->231 3c3wB PDBj 3e-17 21.8 %
:RPS:SCOP  18->131 1a0oA  c.23.1.1 * 8e-13 17.5 %
:RPS:SCOP  140->233 1gxpA  a.4.6.1 * 2e-16 24.5 %
:HMM:SCOP  14->203 1s8nA_ c.23.1.1 * 7.2e-21 28.6 %
:RPS:PFM   19->125 PF00072 * Response_reg 7e-07 35.5 %
:RPS:PFM   164->231 PF00486 * Trans_reg_C 3e-06 44.1 %
:HMM:PFM   163->233 PF00486 * Trans_reg_C 1.4e-16 40.8 71/77  
:HMM:PFM   19->126 PF00072 * Response_reg 2e-13 27.8 108/112  
:BLT:SWISS 18->231 YKOG_BACSU 6e-24 34.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69323.1 GT:GENE BAC69323.1 GT:PRODUCT putative two-component system response regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1978871..1979575) GB:FROM 1978871 GB:TO 1979575 GB:DIRECTION - GB:PRODUCT putative two-component system response regulator GB:NOTE PF00486: Transcriptional regulatory protein, C terminal GB:PROTEIN_ID BAC69323.1 LENGTH 234 SQ:AASEQ MYGRASERPLLARGDGRHVLIVVDDPEIAELLSTTMELAGFRISVADTAGEAVARLVKRRFDLVVLDADLSDMTELAQEPRLAVVERPRVLLLAEYDSLDRLLPELGPGETDYVTKPLRIAEVLARAQVLLHGRRRVRREGTLGYGDLVLDDSTCQAWRGQRALDLTPAEYRLLRHLLVNANKVLSKERIGRFVRGEFRGGNAIEQLVSRVRRKVDRDGPPLIHTRRGFGYWLG GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 18->231|YKOG_BACSU|6e-24|34.1|214/228| BL:PDB:NREP 1 BL:PDB:REP 19->231|1kgsA|4e-17|31.8|201/211| RP:PDB:NREP 1 RP:PDB:REP 18->231|3c3wB|3e-17|21.8|202/210| RP:PFM:NREP 2 RP:PFM:REP 19->125|PF00072|7e-07|35.5|107/111|Response_reg| RP:PFM:REP 164->231|PF00486|3e-06|44.1|68/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 163->233|PF00486|1.4e-16|40.8|71/77|Trans_reg_C| HM:PFM:REP 19->126|PF00072|2e-13|27.8|108/112|Response_reg| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 18->131|1a0oA|8e-13|17.5|114/128|c.23.1.1| RP:SCP:REP 140->233|1gxpA|2e-16|24.5|94/103|a.4.6.1| HM:SCP:REP 14->203|1s8nA_|7.2e-21|28.6|189/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 6388 OP:NHOMOORG 818 OP:PATTERN -------------------------------------------------------------------- 4A93736455634579988-892278888885B99A4AA94468355746447682571185A3B69ECA4333353346E96-32455654-211---11713271A54--------------122322113221DDDEE937E3GAG9AA75788555687A639DBJ44634444544348743323-73CMMNMNHLMFMJONLI9B6679LMR57AJ6C9666666VQ555555545555555555558575BA53234554499544462342888343546655555555555122222222222272344433345IFGQHHHNKINHIDBNMM68B7II9458BH52SOE66334436555-26933577543333B6DBF8479F9BD77677777669-88997DA86F41FBBFB8BDFCA9AG57465A85895558888888867655877----------1111-1212212222----22683358759JLMLLGCBBB9KKLIDCDD7DKHGCGGM-2FHID7A86HAADB4BGA564653111111164289A56522221451222-A676756464442231552143223221-1-------4315544BB468AE5987CBGGD6FDGFFFDGEEHGE--22215------988A797BCCCBCCDBB-CDCBBBBBBDCBBBBBBBADCD8A6679899999989989899CA99AABB7-8AAAAAAAAAAA--1622221343378A8E111111111111--3A977A6877895JJMJJOQPCLNMOFHGJ21-1-21-13888G88888CCE9AGG97A789985545--71223355------------------------------------2623333443252 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1-------1--------------5-----3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 234 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHccHEEEEEEcccHHHHHHHHHHHHTcTTEEEEEccHHHHHHHHHHHcccEEEEccEETTEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHETTEHHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHHHHHHTccHHcccccTHHHHHHHHHHHHHTTccccHHHHHHHHHTcEEc DISOP:02AL 1-15, 133-142| PSIPRED cccccccccccccccccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHccccEEEEEEccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccEEEEccEEEEcccEEEEEccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHccccccccEEEHHHHHHHHHHccccccEEEEEEcccEEcc //